KEGG   Bipolaris oryzae: COCMIDRAFT_99783Help
Entry
COCMIDRAFT_99783  CDS       T03125                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bor  Bipolaris oryzae
Pathway
bor04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bor00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    COCMIDRAFT_99783
Enzymes [BR:bor01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     COCMIDRAFT_99783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 19129532
NCBI-ProteinID: XP_007689653
JGI: Cocmi1_99783
UniProt: W6Z296
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MNTTLLRTSALRSAARAAAPVTSRAGLAGTTFVRGKATLPDLPYDYGALEPSISGKIMEL
HHKNHHNTYVTSFNNFSEQIAEAKQKQDIQAQIALQPLINFHGGGHINHTLFWENLAPIN
QGGGEPPSGALAAAINTNYGSLDAFKEKFNTALAGIQGSGWAWLVQDTQTGGIQIKTYAN
QDPVVGQFRPILGVDAWEHAYYLDYQNRKAEYFKAIWNVINWKAAEKRFK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaacactactcttctccgcacatccgccctccgctcggctgcccgagctgccgcgccc
gtcacctcgcgggctggactggccggtaccacctttgttcgcggaaaggctactctgccc
gaccttccttacgactatggcgcgcttgagccctccatctcgggcaagatcatggagcta
caccacaagaaccaccacaacacctacgtgacctcgttcaacaacttcagcgagcagatt
gccgaggccaagcagaagcaggatatccaggctcagattgccctgcagccgctcatcaac
ttccatggcggcggccacatcaaccatacccttttctgggagaatctcgcacctatcaac
cagggtggtggcgagccaccatctggcgctctcgctgctgccatcaacaccaactatggc
agccttgacgctttcaaggagaagttcaacactgcgctcgcaggtatccagggcagcgga
tgggcatggctggtgcaggacacgcagactggcggcatccagatcaagacatatgccaac
caggaccctgtagttggccagttccgccccatcctcggtgtcgacgcgtgggagcacgcc
tactaccttgactatcagaaccgcaaggctgagtacttcaaggcaatctggaacgttatc
aactggaaggcggccgagaagcgtttcaagtaa

DBGET integrated database retrieval system