KEGG   Bipolaris oryzae: COCMIDRAFT_99995Help
Entry
COCMIDRAFT_99995  CDS       T03125                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bor  Bipolaris oryzae
Pathway
bor00052  Galactose metabolism
bor00500  Starch and sucrose metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    COCMIDRAFT_99995
   00500 Starch and sucrose metabolism
    COCMIDRAFT_99995
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     COCMIDRAFT_99995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19129583
NCBI-ProteinID: XP_007689742
JGI: Cocmi1_99995
UniProt: W6ZJI1
LinkDB All DBs
Position
Unknown
AA seq 908 aa AA seqDB search
MIRHILLGLAACSSFTNAAPLVHEATDLAATLTRRAEVDSCPGYTASNVVEKDSTLTADL
TLAGDACNAYSDDIKNLKLLVEYQNNERLHVKIYDADLQVFQVQESVFPRPKHEKASTDS
TALQFDVKESPFSFTVKRRDGGEVLFDTETVPLVFEKQYVRLRTKLPDNPNIYGLGEHSD
SFRFHTDKYERVFLNGESINIPTNANLYGSHPVYFDHRGGKGTHGVFMLNSSPMQVDIKK
ADSGYQYLEYNTVGGVIDLYFMAGSKPAEVSKQYADVAGYSAMYPYWTLGFHQCKYGYWD
VNMVAEVVANYSTAGIPLEVMWTDIDYMHLREDFTTDPDRFPLSKMRELVSTLHSRDQKY
VLILDPGVHAVGNYEPYEKGHEMEVFLKAADGTDFLGVQWPGEVAWPDWFAPNTQEWWTQ
EILKQFDADSGINLDGLWVDMNEASNFCQDPQTCNPRQKAIDDGIPPKPGNAPRPNTGRP
IPGFPASFQPSSGNSSSAGIITPRQSANGSMKGFPDRNWFDPAYRVNSHLGKISQQTIAM
NTTNYDGTWQYDTHNLYGSMMASATRESMLIRRPKVRPFVLTRSTFAGIGRKVAHWFGDN
ASIWEHYRTSIRQMLSFVSMHQMPMVGSDVCGFNGNADQYMCARWAVLGAFQPFYRNHAE
LSTIQQEFYQWPVVANAAKKAIETRYKLMDYIYTALYYQTQDGTPMINPLFFLYPEDEKT
FDIQEQWFYGNALLISPVTVDYSDTVTFYLPNDVFYDYWTYGKVQGQGQNVTVSNLTYSD
IPVHIRGGSIIPHRVNSANTTKALRNEDFFVLVAPDAQGKAAGQLYLDDGESIEQAGTSE
INFSFDNGKFSATGSFGYKAQGAESLAVARVVVLGQAQEGATGDFDAKKQTIEVKGPWTL
DTEFGFDL
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgatacgccatattttgctcgggcttgccgcctgctcgagcttcactaatgcggctcct
ctagtgcacgaggctactgacctcgctgctaccctcactcgccgcgcagaagtggatagc
tgccctggctatactgcctcgaatgttgttgaaaaagactctactttgacggccgatctc
actctcgctggtgatgcctgcaatgcatacagcgacgatattaagaatttaaagttgctc
gtcgagtaccaaaataatgagcgtcttcacgtcaaaatctacgatgccgacctccaggtt
ttccaggtccaagaatcagtcttcccccggccaaaacacgagaaagcatcaacggacagc
acggccctccaatttgatgtaaaggaaagtccgttttcttttacagtcaagcgcagggat
ggtggtgaggttctttttgatactgaaaccgtccccctggtcttcgagaaacagtacgtg
cgccttcggaccaagctccctgacaacccaaacatctacggtctcggtgagcacagtgat
tcgttccgcttccatacggataagtacgagcgtgtgtttttgaacggcgagtccattaac
attcccaccaacgccaatctgtatggctctcacccagtgtattttgaccaccgtggtggt
aagggtactcatggtgttttcatgctcaactcgagtccgatgcaagtggacattaaaaag
gccgacagtggttatcagtacctagagtacaacaccgttggtggagtcattgatttgtac
ttcatggctggcagcaagcccgccgaggtttccaagcaatacgctgatgttgccggttac
tctgcaatgtacccatactggactcttggtttccaccagtgcaagtacggatactgggat
gtcaacatggttgcggaagttgttgccaactactccactgctggaattcctctcgaggtc
atgtggaccgatatcgactacatgcaccttcgcgaggactttaccaccgatcctgatcgt
ttcccgctctcaaagatgcgtgaattggtatcaactcttcactcgcgcgatcagaagtac
gtcctgatcttggatcctggtgttcatgcggtcggcaactacgagccttacgagaagggc
catgaaatggaggttttccttaaggctgccgatggtactgatttccttggagtccagtgg
cctggagaggtcgcatggcccgattggtttgcacccaacacccaggagtggtggacacag
gaaattctcaagcagtttgatgctgatagcggtattaaccttgatggactctgggtcgac
atgaacgaggcatccaatttttgccaggaccctcagacttgcaacccccgccaaaaggct
atcgacgatggtatcccaccaaaacctggaaatgctcctcgccccaacactggtcgccct
atccccggcttcccagcgtcgttccagccttcttccggtaacagctcatccgctggtatc
attactccacgtcaatccgccaacggcagcatgaagggtttcccagaccgcaactggttc
gaccctgcttaccgcgtcaacagccatctcggtaagatctcgcagcagaccattgcaatg
aacacgacaaactacgatggaacctggcagtacgacacgcacaacctgtacggcagcatg
atggcctcggcaacccgcgaatccatgctcatccgtcgtcccaaggtccgtccctttgtc
ctcacccgctccacattcgcgggaatcggccgcaaggtagcacattggttcggtgacaac
gcctccatctgggagcactaccgcacctccatccgccagatgctgtccttcgtctccatg
caccaaatgcccatggtcggctccgatgtgtgtggcttcaacggcaacgcagatcaatac
atgtgcgcacggtgggccgtattgggcgccttccagcccttctaccgcaaccacgccgaa
ctcagcactatccagcaagaattctaccaatggcccgttgtcgccaatgccgccaaaaag
gccatcgagacccgttacaaactcatggactatatctacaccgccctctactaccaaacc
caagacggcactccaatgatcaacccactgttcttcctctacccagaagacgaaaagact
ttcgacatccaagaacaatggttctacggtaatgcccttcttatctcccccgtgacagtc
gattactcggacacagtcacgttctacctgcccaacgacgtcttctacgactactggacc
tacggaaaagtgcagggccagggccaaaacgtcacagtcagcaacctaacctacagcgac
atccctgtgcatattcgtggtggaagcataatcccgcaccgcgtgaacagcgcgaatacc
acaaaggcgctgcgtaacgaggactttttcgtgctcgtggcccctgatgcacagggtaaa
gcggcggggcagttgtaccttgatgacggggagagcatcgagcaagccggcactagcgag
attaacttttcctttgataatggcaagtttagtgctacggggtcgtttgggtataaggcg
cagggcgcggagagcctcgcagttgcgcgggtcgtggtattgggccaggcgcaggagggc
gcgacgggcgattttgatgccaagaagcagactattgaggtcaaggggccgtggaccttg
gacacggagtttggctttgacctgtga

DBGET integrated database retrieval system