KEGG   Bosea sp. RAC05: BSY19_1010Help
Entry
BSY19_1010        CDS       T04462                                 

Gene name
ntrB
Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bos  Bosea sp. RAC05
Pathway
bos00910  Nitrogen metabolism
bos02010  ABC transporters
Module
bos_M00438  Nitrate/nitrite transport system
bos_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSY19_1010 (ntrB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSY19_1010 (ntrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bos02000]
    BSY19_1010 (ntrB)
Transporters [BR:bos02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BSY19_1010 (ntrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOG03539
UniProt: A0A1B3NDX8
LinkDB All DBs
Position
complement(1082807..1083715)
Genome map
AA seq 302 aa AA seqDB search
MGRAVLKEVETGATVVALPGAKPGVVPLPAPARKPLSSRLLPWLRAILVNVLPPLVTVAL
IALFWQIAASGPQSSLPPPTKIWEEAKDLIVEPFYWAGSQDIGLGWRILVSLQRVAIGFS
LAAIVGVLLGALVGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFRDSQPSAIFVIFIT
AIWPVIINTAVGIRNIPQDYRNVAQVLRLNQVEFFFKIMVPSAAPYIFTGLRIGVGLSWL
AIVAAEMLTGGVGIGFFIWDAWNSSRLSDIIVALVYIGVVGFLLDRLVAFVGAIVTRGTI
VN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggccgtcctgaaggaagtggagacgggcgcgacggtggtcgccctgcccggt
gccaagcccggcgtggtgccgctgccagcgccggcccgcaagccgctctcgtccaggctg
ctgccctggctgagagcgatcctcgtcaatgtgctgccacctttggtcaccgtcgcgctg
atcgcgctgttctggcagatcgccgcgtcgggcccgcaatcctcgttgccgccgccgacc
aagatctgggaggaggccaaggatctgatcgtcgagccgttctactgggcgggctcccag
gacatcgggctgggctggcgcatcctggtctcgctgcagcgcgtcgccatcggcttcagc
ctggcggcgatcgtcggcgtgctgctgggtgcgctcgtcggccagtcggtctgggcgatg
cgcgggctcgacccgatcttccaggtgctgcgcaccgtgccgccgctcgcctggctgccg
ctctcgctggcggcgttccgcgacagccagccctcggcgatcttcgtgatcttcatcacc
gcgatctggccggtgatcatcaacaccgcagtgggtatccgcaacatcccgcaggactac
cgcaatgtcgcgcaggtgctgcggctgaaccaggtcgagttcttcttcaagatcatggtg
ccctcggcggcgccctacatcttcaccggccttcgcatcggcgtcggcctgtcctggctc
gccatcgtcgcggcggaaatgctcaccggcggcgtcggcatcggcttcttcatctgggat
gcgtggaactcctcgcgcctgtccgacatcatcgtggcgctcgtctacatcggcgtggtc
ggcttcctgctcgaccggctggtcgccttcgtcggcgcgatcgtcacccgcggcacgatc
gtgaactga

DBGET integrated database retrieval system