KEGG   Bosea sp. RAC05: BSY19_1198Help
Entry
BSY19_1198        CDS       T04462                                 

Gene name
fabA
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
bos  Bosea sp. RAC05
Pathway
bos00061  Fatty acid biosynthesis
bos01100  Metabolic pathways
bos01212  Fatty acid metabolism
Module
bos_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSY19_1198 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bos01004]
    BSY19_1198 (fabA)
Enzymes [BR:bos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BSY19_1198 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     BSY19_1198 (fabA)
Lipid biosynthesis proteins [BR:bos01004]
 Fatty acid synthase
  Component type
   BSY19_1198 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AOG04010
UniProt: A0A1B3NF79
LinkDB All DBs
Position
1286657..1287169
Genome map
AA seq 170 aa AA seqDB search
MQRQSSFSYEEILACGRGELFGPGNAQLPLPPMLMFDRITEIAEDGGPNGKGFVRAEFDI
KPDLWFFDCHFKGDPVMPGCLGLDALWQLTGFFLGWLGLPGRGRALGVGEVKFADQVLPS
VKQVVYGVEFKRVFKSKLVLGIADGWLEADGKRIYTVSDMRVGLFKPEAA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggcaatcgtctttcagctacgaggagatcctcgcctgtggtcgcggggagctg
ttcgggccgggcaacgcgcagctgccgctgccgccgatgctgatgttcgaccgcatcacc
gagatcgccgaagatggcggccccaacggcaagggcttcgtgcgcgccgaattcgacatc
aagccggatctctggttcttcgactgccacttcaagggcgatccggtgatgccgggctgc
ctgggcctcgatgccctctggcagttgaccggtttcttcctcggctggctcggtcttccc
ggccgcgggcgggcgctcggcgtcggcgaggtcaagttcgccgaccaggtgctgccctcg
gtcaagcaggtcgtctacggcgtcgagttcaagcgcgtcttcaaatccaagctcgtgctc
ggcatcgccgatggctggctggaggccgacggcaagcgcatctacacggtcagcgacatg
cgcgtcggcctgttcaagcccgaggcggcgtaa

DBGET integrated database retrieval system