KEGG   Bosea sp. RAC05: BSY19_2545Help
Entry
BSY19_2545        CDS       T04462                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bos  Bosea sp. RAC05
Pathway
bos00061  Fatty acid biosynthesis
bos00780  Biotin metabolism
bos01100  Metabolic pathways
bos01212  Fatty acid metabolism
Module
bos_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSY19_2545 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSY19_2545 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bos01004]
    BSY19_2545 (fabZ)
Enzymes [BR:bos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BSY19_2545 (fabZ)
Lipid biosynthesis proteins [BR:bos01004]
 Fatty acid synthase
  Component type
   BSY19_2545 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AOG04963
UniProt: A0A1B3NHZ3
LinkDB All DBs
Position
2684368..2684826
Genome map
AA seq 152 aa AA seqDB search
MTEATTTLGVADIQKIMACIPHRYPFLLVDRVVEINGDESGVGIKNVTINEPQFTGHFPD
RPVFPGVLMIEAMAQTAGVLVVNARGSDDTAVRSVLFTTIDKAKFRKPVGPGDTLRFHLT
KIARKRNIYFYRGEARVDGVLVAEADLSAMVV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgacgacgacgctgggtgtggccgacatccagaagatcatggcctgcatt
ccccaccgctacccctttctgctggtcgaccgcgtcgtcgagatcaacggcgacgaatcg
ggcgtcggcatcaagaacgtcacgatcaacgagccgcagttcaccggccatttccccgac
aggccggtgttccccggcgtgctgatgatcgaggccatggcgcagacggcgggtgtcctc
gtcgtcaatgcccgcggcagcgacgatacggccgtccgcagcgtgctcttcacgacgatc
gacaaggcgaagttccgcaagcccgtcggcccaggcgacacgctgcgcttccacctcacc
aagatcgcccgcaagcgcaacatctacttctacaggggcgaggcgcgcgtcgacggcgtg
ctcgtcgccgaggccgatctctccgcgatggtcgtctga

DBGET integrated database retrieval system