KEGG   Bosea sp. RAC05: BSY19_3179Help
Entry
BSY19_3179        CDS       T04462                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bos  Bosea sp. RAC05
Pathway
bos00564  Glycerophospholipid metabolism
bos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSY19_3179
Enzymes [BR:bos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSY19_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_2 GIDA 3HCDH_N Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AOG04007
UniProt: A0A1B3NF85
LinkDB All DBs
Position
3344548..3346074
Genome map
AA seq 508 aa AA seqDB search
MTETGMTQTETTYDLAVIGGGINGCGIARDAAGRGASVVLFEKDDLAGATSSASTKLIHG
GLRYLEHYEFRLVREALMERERLWAMAPHIIWPLRFVLPHHKGLRPAWLLRLGLFLYDHI
GGRKKLPATRTVDLSQDAAGRPLKDNGATAFEYSDCWVEDSRLVVLNAMDAAAKGAAIHT
RARVVSADREGGVWRITAETNGTSRSIRAKALVNAAGPWVGDVLGGVVRSNTKAAVRMVQ
GSHIVVPRLYDHDRCYIFQNADGRIIFAIPYERDFTLIGTTDRDYRGNPADAKATPEEID
YLCAAASEYFREPVTPASVVWTYSGVRPLYDDGASKAQEATRDYVLTLDAPQGQAPLLSV
FGGKITTYRRLAESALEKLGPHAAWAARPTWTITGTLPGGDFPVEGYDAQVDALASAHPW
LARTTIARLVRAYGTKAREILQGAGQEADFGRHFGADLYEREVRYLMRAEWATRAADVLW
RRSKLGLRLSADEQEALEAFMAEAAANG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccggaatgacgcagacggaaaccacctacgacctcgccgtcattggcggc
ggcatcaatggctgcggcatcgcccgcgacgcggcggggcgcggcgcctccgttgtcctc
ttcgagaaggacgacctcgccggcgccacctcctccgcctcgaccaagctcatccatggc
gggctgcgctatctcgagcattacgagttccggctcgtgcgggaggcgctgatggagcgc
gaacggctctgggcgatggccccgcacatcatctggccgctgcgcttcgtgctgccgcat
cacaagggcctccgcccggcctggctgctgcggctcggcctgttcctctacgaccatatc
ggcggccgcaaaaaactgccggcgacgcgcaccgtcgacctctcgcaggacgccgccggc
cggccgctcaaggacaatggcgccaccgccttcgaatactccgactgctgggtcgaggat
tcgcgcctcgtcgtgctcaacgccatggacgccgccgcgaagggcgccgcgatccacacc
cgcgcccgcgtcgtctcggccgatcgcgagggcggcgtctggcgcatcaccgcggagacg
aacggcacgagccgcagcatccgggcgaaggcgctggttaatgcggccgggccctgggtc
ggcgacgtgctcggcggcgtcgtccgctccaataccaaggccgccgtccgcatggtccag
ggcagccatatcgtcgtgccccggctctacgatcacgaccgttgctacatcttccagaac
gccgacgggcgcatcatcttcgccatcccctatgagcgcgacttcaccctgatcggcacg
accgaccgcgattatcgcggcaatcccgccgacgccaaggcgacgcccgaggagatcgac
tatctctgcgccgccgcgagcgagtatttccgcgagccggtgacgccggcctccgtggtc
tggacctattccggcgtgcgcccgctctatgacgacggcgccagcaaggcgcaggaggcg
acgcgcgactatgtcctgacgctcgacgcgccgcagggccaggcgccgctgctctcggtc
ttcggcggcaagatcacgacctatcgccgcctcgccgaatccgcgctggaaaagctcggg
ccccatgccgcctgggccgcgcgcccgacctggaccatcaccggcacgctgccgggcggc
gatttccccgtcgagggctatgacgcgcaggtcgacgcgctcgcatccgcccatccctgg
ctggcccgcacaacgatcgcgcggctggtgcgggcctatggcaccaaagcgcgcgagatc
ctgcagggcgctggccaggaggccgatttcggccgccatttcggcgccgatctgtacgag
cgcgaggtccgctacctcatgcgggcggagtgggcgacgcgggccgccgacgtgctctgg
cgccgcagcaagctgggcttgcgcctctcggcggacgagcaggaggcgctggaggccttc
atggcggaggcggcggcaaacggctga

DBGET integrated database retrieval system