KEGG   Bosea sp. RAC05: BSY19_4103Help
Entry
BSY19_4103        CDS       T04462                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
bos  Bosea sp. RAC05
Brite
KEGG Orthology (KO) [BR:bos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSY19_4103
Enzymes [BR:bos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     BSY19_4103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc DNA_pol3_delta2
Motif
Other DBs
NCBI-ProteinID: AOG06063
UniProt: A0A1B3NL37
LinkDB All DBs
Position
4301703..4302740
Genome map
AA seq 345 aa AA seqDB search
MRAVVIHAEKDLRVDEVTVGEPGPRQVRVKIEAGGICGSDLHYYLHGGFGTIRVREPLIL
GHEIAGRIECVGAEVTRVKVGDRVAVNPSRACGQCRYCQMGQQQHCTDMLFYGSAMRFPH
VQGGFREMLVIEERQAVKVADHVTAAEAAFAEPLAVCLHAVKRAGPLLGKRVLVTGSGPI
GILTIIAAKAAGAAEIVATDVVDGPLPTALKMGASRAINVMAEPDRLKAEYGAEKGAFDV
MFEASGNQHALTGAFDVVRSGGVIVQIGVGGNFTLPMNVVVAKEFDLRGSFRFHEEFDWA
VAMIGSKTIDLSPLLTATIPVERAIEAFDLAADKSKAMKVQLAFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcgtcatccatgccgaaaaggacctccgcgtcgacgaggtcaccgtcggc
gaacccggtccgcgccaggtccgcgtcaagatcgaggccggcggcatctgcggctcggac
ctgcattactacctgcatggcggcttcggcacgatccgcgtgcgcgagccgctgatcctc
ggccatgagatcgcgggccggatcgaatgcgtcggcgccgaggtcacgcgcgtcaaggtc
ggggatcgcgtcgccgtcaatcccagccgcgcctgcgggcagtgccgctactgccagatg
ggccagcagcagcactgcacggacatgctgttctacggcagcgccatgcgcttcccccat
gtccagggcggcttccgcgagatgctggtgatcgaggagcgccaggcggtgaaggttgcc
gatcacgtgaccgctgctgaagccgccttcgccgaaccgctcgcggtctgcctccatgcc
gtcaagcgggccggcccgctgctcggcaagcgcgtcctcgtcaccggctcggggccgatc
ggcatcctcaccatcatcgccgccaaggccgccggcgcggccgagatcgtcgcgaccgat
gtggtcgacggccccctgccgacggcgctgaagatgggcgccagccgcgccatcaacgtc
atggccgagccagaccgcctgaaggccgagtacggcgcggaaaagggcgccttcgacgtc
atgttcgaggcctcgggcaaccagcacgcgctgaccggcgccttcgacgtggtgcgctcg
ggcggcgtgatcgtgcagatcggcgtcggcggcaacttcaccctgccgatgaacgtcgtc
gtcgctaaggagttcgacctgcgcggctccttccgcttccacgaggagttcgactgggcg
gtggcgatgatcggctcgaagaccatcgacctctcgccgctcttgaccgccaccatcccc
gtcgagcgcgcgatcgaagccttcgacctcgccgccgacaagtcgaaggcgatgaaggtc
cagctcgccttcgggtga

DBGET integrated database retrieval system