KEGG   Bosea sp. RAC05: BSY19_4231Help
Entry
BSY19_4231        CDS       T04462                                 

Gene name
lpdA
Definition
(GenBank) dihydrolipoyl dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bos  Bosea sp. RAC05
Pathway
bos00010  Glycolysis / Gluconeogenesis
bos00020  Citrate cycle (TCA cycle)
bos00260  Glycine, serine and threonine metabolism
bos00280  Valine, leucine and isoleucine degradation
bos00310  Lysine degradation
bos00380  Tryptophan metabolism
bos00620  Pyruvate metabolism
bos00630  Glyoxylate and dicarboxylate metabolism
bos00640  Propanoate metabolism
bos01100  Metabolic pathways
bos01110  Biosynthesis of secondary metabolites
bos01120  Microbial metabolism in diverse environments
bos01130  Biosynthesis of antibiotics
bos01200  Carbon metabolism
Module
bos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSY19_4231 (lpdA)
   00020 Citrate cycle (TCA cycle)
    BSY19_4231 (lpdA)
   00620 Pyruvate metabolism
    BSY19_4231 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSY19_4231 (lpdA)
   00640 Propanoate metabolism
    BSY19_4231 (lpdA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSY19_4231 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    BSY19_4231 (lpdA)
   00310 Lysine degradation
    BSY19_4231 (lpdA)
   00380 Tryptophan metabolism
    BSY19_4231 (lpdA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bos04147]
    BSY19_4231 (lpdA)
Enzymes [BR:bos01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BSY19_4231 (lpdA)
Exosome [BR:bos04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSY19_4231 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 FAD_oxidored K_oxygenase FAD_binding_2 GIDA HI0933_like Thi4 AlaDh_PNT_C 3HCDH_N FAD_binding_3 Lycopene_cycl DAO
Motif
Other DBs
NCBI-ProteinID: AOG03870
UniProt: A0A1B3NEU0
LinkDB All DBs
Position
complement(4433109..4434509)
Genome map
AA seq 466 aa AA seqDB search
MSYDLVVIGTGPGGYVCAIRAAQLGLKVAVVEKRKTHGGTCLNVGCIPSKAMLHASEMFE
EAGHSFAKLGIVVGQPKLDLKAMFAHKQETVDANVNGVAFLLKKNKIEPFHGTASIPGAG
KVVVTAEDGSTKELETKNIVIATGSEAAGLPGVTVDEKTVVTSTGALELAAVPKELVVVG
AGVIGLEIGSVWGRLGAKVTVIEYLDRILPGMDAEVAKQFQRILEKQGFSFRLGAKVTKV
ETGKKGGATLTVEPSAGGEASTLAADIVLVAIGRRPNTDGLGLEGAGVATERGRVVIDDH
FKTNVAGIYAIGDVVRGPMLAHKAEDEGVAVAEIIAGKHGHVNYDAIPGVVYTSPEVASL
GKTEEELKAAGVDYKVGKFPFTANGRARAMRQTDGFVKVLADAKTDRVLGCHIIGPRAGD
LIAEVTVLMEFGGSSEDLARTCHAHPTLAETVKEAAMAVEKRQIHM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgatctcgtcgtcatcggtaccggccccggcggctatgtctgtgccatccgc
gccgcccagctcggcctcaaggtcgcggtggtcgagaagcgcaagacgcatggcggcacc
tgcctcaatgtcggctgcatcccctccaaggcgatgctgcacgcctccgagatgttcgag
gaggccggccacagcttcgccaagctcggcatcgtcgtcggccagcccaagctcgacctg
aaggcgatgttcgcgcacaagcaggagacggtggacgccaacgtcaacggcgtcgccttc
ctgctgaaaaagaacaagatcgagcccttccacggcaccgcctcgatccccggcgccggc
aaggtcgtcgtcaccgccgaggacggctccacgaaggagctcgagaccaagaacatcgtc
atcgccaccggctcggaggccgccggtctgccgggcgtgacggtcgacgagaagacggtc
gtgacctcgacgggggcgctcgaactcgccgccgttcccaaggagctggtcgtggtcggc
gcgggcgtgatcggcctcgagatcggttcggtctggggccggctcggcgccaaggtcacc
gtgatcgaatatctcgaccgcatcctcccgggcatggacgccgaggtcgccaagcagttc
cagcgcatcctggagaagcagggcttcagcttccgcctcggtgccaaggtcaccaaggtc
gagacgggcaagaagggcggcgcgacgctgacggtcgagccctcggccggcggtgaggcg
agcacgctggccgctgacatcgtgctggtggcgatcggccgccgcccgaacacggacggg
ctcgggctggagggtgcgggcgtcgcgaccgagcggggccgcgtcgtcatcgatgatcat
ttcaagaccaatgtcgcgggcatctacgccatcggcgacgtggtgcgcggcccgatgctg
gcgcacaaggccgaggacgagggcgtcgcggtcgccgagatcatcgccggcaagcacggc
catgtgaactacgacgcgatccccggcgtcgtctacacctcgccggaggtcgcttcgctc
ggcaagaccgaggaggagctgaaggccgcgggcgtcgactacaaggtcggcaagttcccc
ttcaccgccaatggccgcgcccgcgcgatgcgccagaccgacggcttcgtgaaggtgctg
gccgatgccaagaccgatcgcgtcctgggttgccacatcatcgggccccgcgcgggcgat
ctgatcgccgaagtgaccgtgctgatggagttcggcggctcgtcggaagacctcgcccgc
acctgccacgcccatccgacgctggccgagacggtcaaggaagcggcgatggccgtcgag
aagcgccagatccatatgtga

DBGET integrated database retrieval system