KEGG   Bosea sp. RAC05: BSY19_518Help
Entry
BSY19_518         CDS       T04462                                 

Gene name
tme
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bos  Bosea sp. RAC05
Pathway
bos00620  Pyruvate metabolism
bos01100  Metabolic pathways
bos01120  Microbial metabolism in diverse environments
bos01200  Carbon metabolism
Module
bos_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:bos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY19_518 (tme)
Enzymes [BR:bos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BSY19_518 (tme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AOG05606
UniProt: A0A1B3NJV8
LinkDB All DBs
Position
554253..556370
Genome map
AA seq 705 aa AA seqDB search
MLAIAEDPTRSYDYTARGNLVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADVDS
IDLEVDTEDADKFIEAVRYLGPSFGGINLEDIKAPECFMIEQRLRELMDIPVFHDDQHGT
AIIAAAGLINALDLTGRDVKTTRLVINGAGAASIACTELLKAMGFKPDNVILCDTKGVIY
QGRTEGMNQWKSAHAAITDRRTLAQAMDGADAFFGLSQKGAVTPQMVASMAKNPIIFAMA
NPDPEITPEEVHAVRDDAIMATGRSDYPNQVNNVLGFPFIFRGALDVRAKTINMEMKIAA
AEALASLAREDVPDEVAAAYQGSRPRYGKDYIIPVPFDPRLIQVVPMAVAKAAMETGVAG
KPIVDMNAYKAQLSARRDPVAGTLNRIFERVRRYPKRVVFAEGEEEQVIRAAVSFVNQGL
GHAILVGREERVFETATFLGIDLETKGISVQNARLSKRNAAYAQYLYERLQRQGYLFRDC
QRLINQDRNHFAAAMVALGDADAMVTGVTRNYSIALEEVRRVIDEKPGHRVIGVSIVLSR
ERTVLVADTAITEMPTAKELSEIAIEAAGVARRLGYEPKVAMLAFSTFGHPAGERSEKVR
EAVKLLDAQRVDFEYDGEMAADVALNRDLMAQYPFCRLSGPANVLIMPAFHSASISTKML
QELGGSTVIGPLIVGLDKPVQIVPLGAKDSDIVNMAALAAFNIGG
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcgatcgcggaggatccgacccgctcctacgactacacggcgcggggcaacctc
gtcgcggtgatctcgaacggcaccgccatcctcggcctcggcaatctcggcgcgctcgcc
tccaagccggtgatggagggcaaggcggtcctgttcaagcgcttcgccgacgtcgactcg
atcgatctcgaggtcgacaccgaggatgccgacaagttcatcgaggcggtgcgctatctc
ggcccctccttcggcggcatcaatctcgaggacatcaaggcgccggaatgcttcatgatc
gagcagcgcctgcgcgagctcatggacatcccggtcttccatgacgaccagcacggcacc
gcgatcatcgccgccgccggcctgatcaacgcgctcgatctcaccgggcgcgacgtcaag
acgacgcgcctcgtcatcaacggcgccggcgcggcctcgatcgcctgcaccgagctgctc
aaggcgatgggcttcaagcccgacaacgtcatcctctgcgacaccaagggcgtgatctac
cagggccgcaccgagggcatgaaccagtggaagtcggcccatgccgccatcacggaccgg
cgcacgctggcccaggcgatggacggggcggatgccttcttcggcctgtcgcagaagggc
gcggtgactccgcagatggtcgcctcgatggcgaagaacccgatcatcttcgcgatggcc
aatcccgatccggaaattacgccggaggaggtccatgccgtgcgcgacgacgccatcatg
gcgacgggccgctccgactatcccaatcaggtcaacaacgtcctgggcttccccttcatc
ttccgcggcgcgctcgacgtgcgtgccaagaccatcaacatggagatgaagatcgccgcc
gccgaggcgctggcctcgctcgcccgcgaggacgtgcccgacgaggtcgctgccgcctat
cagggctcccgcccgcgctacggcaaggactacatcatcccggtgcccttcgatccgcgg
ctgatccaggtcgtgccgatggcggtggccaaggcggcgatggagaccggcgtcgccggc
aagccgatcgtcgacatgaacgcctacaaggcgcagctctcggcccggcgcgacccggtc
gccggcacgctgaaccgcatcttcgagcgcgtccggcgctatcccaagcgcgtcgtcttc
gccgagggcgaggaggagcaggtgatccgtgccgcggtgtccttcgtcaaccaggggctc
ggccacgccatcctggtcggccgcgaggagcgcgtcttcgagaccgcgacgttcctcggc
atcgacctcgagaccaagggcatctcggtccagaacgcgcggctgtcgaagcgcaacgcg
gcctatgcccagtatctctacgagcgcctgcagcggcagggctacctgttccgcgactgc
cagcgactgatcaaccaggaccgcaaccatttcgccgcggccatggtcgcgctcggcgac
gcggatgcgatggtcaccggcgtgacccgcaactactcgatcgcgctggaggaggtccgc
cgcgtcatcgacgagaagccggggcaccgcgtcatcggcgtctcgatcgtgctgtcgcgc
gagcgcaccgtgctggtcgccgacaccgccatcaccgagatgccgacggccaaggagctg
tccgagatcgcgatcgaggccgcgggcgtcgcccggcggctgggctacgagcccaaggtc
gcgatgctcgccttctcgaccttcggccacccggcgggcgagcgctcggagaaggtgcgc
gaggcggtgaagctgctggacgcccagcgcgtcgacttcgagtatgacggcgaaatggcc
gccgatgtcgcgctcaaccgcgatctaatggcgcagtatcccttctgccgcctcagcggg
ccggcgaacgtgctgatcatgccggcgttccactcggcctcgatctcgaccaagatgctg
caggagctcggcggctcgaccgtgatcggcccgctgatcgtcggcctcgacaagccggtc
cagatcgtgccgctcggcgccaaggacagcgacatcgtcaacatggcggcgctggcggcc
ttcaacatcggcggctga

DBGET integrated database retrieval system