KEGG   Bradyrhizobium ottawaense: CIT37_06645Help
Entry
CIT37_06645       CDS       T05524                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIT37_06645
Enzymes [BR:bot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CIT37_06645
Transporters [BR:bot02000]
 Other Transporters
  Pores ion channels [TC:1]
   CIT37_06645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AWL97928
UniProt: A0A2U8PJN7
LinkDB All DBs
Position
complement(1410560..1411204)
Genome map
AA seq 214 aa AA seqDB search
MTDPNRITLYYSPQSRATGTRVLLEELGARYDLHVLNMKAGEQRQPAYLAINPLGKVPAI
RHGDALVTEQVAITIHLADLFPQAGLTPALNDPLRGPYLRWIAYYGSSFEPALIDKFMQR
EPAPITQSPYADYDTMLGALEAQLSEGPYLLGERMTAADVLWGVAFSWTMMFGIVPKKDV
FVRYAERMTARPAFQRINAADDEMAALHAKAVGG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgaaccgcatcacgctgtattactcgccgcaaagccgcgccaccggcacg
cgggtgctgctggaggagctgggcgcgcgctacgatctgcatgtcctcaacatgaaggcc
ggcgagcagcgtcagcccgcttatctcgccatcaatccgctcggcaaggtcccggcgatc
cgccacggcgatgccctggtgaccgagcaggtcgcgatcaccatccatctcgccgatctc
ttcccgcaggcaggtctgacgcccgccctgaacgatccgctgcgcggtccttatctgcgc
tggatcgcctattacggctcatccttcgagcccgcgctgatcgacaagttcatgcagcgc
gagccggcgccgatcacgcagtcgccctatgccgactacgacaccatgctcggcgcgctg
gaagcgcagctgtcggaagggccctatttgcttggcgagcggatgacggccgccgatgtg
ttgtggggcgtggcgttcagctggaccatgatgttcggcatcgtaccgaagaaggacgtg
ttcgtccgctatgccgaacgcatgaccgcgcggcctgcattccagcgcatcaatgcggcg
gacgacgagatggcggcgctgcatgcgaaggcggttgggggctga

DBGET integrated database retrieval system