KEGG   Bradyrhizobium ottawaense: CIT37_11140Help
Entry
CIT37_11140       CDS       T05524                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00340  Histidine metabolism
bot01100  Metabolic pathways
bot01110  Biosynthesis of secondary metabolites
bot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CIT37_11140
Enzymes [BR:bot01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CIT37_11140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AWL92704
UniProt: A0A2U8P5N2
LinkDB All DBs
Position
complement(2373439..2373759)
Genome map
AA seq 106 aa AA seqDB search
MPRFTIHDLAETIDARAAAGGEASYTRKLLDKGAEHCAKKFGEEAVETVIAAVENDRAHL
IAESADLLYHFLVLLKARGVKLEEVEAALDKRTNMSGLEEKASRKG
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtttcacgatccacgatctggccgagaccatcgacgcccgcgcggcggccggc
ggcgaagcgtcctatacccgcaagctcctcgacaagggcgcagagcattgcgccaagaag
ttcggtgaggaagcagtcgaaaccgtaatcgcagcagtcgaaaacgatcgcgcgcatctg
atcgccgagagtgccgacctgctctatcacttccttgtcttgctgaaggcccgcggcgta
aagctggaagaggtggaagcggcgctcgacaagcgtacgaatatgtcagggctggaagag
aaagcgtcgcgtaagggctag

DBGET integrated database retrieval system