KEGG   Bradyrhizobium ottawaense: CIT37_15800
Entry
CIT37_15800       CDS       T05524                                 

Definition
(GenBank) HAMP domain-containing protein
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bot00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CIT37_15800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bot01001]
    CIT37_15800
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bot02022]
    CIT37_15800
Enzymes [BR:bot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CIT37_15800
Protein kinases [BR:bot01001]
 Histidine kinases
  OmpR family
   CIT37_15800
Two-component system [BR:bot02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   CIT37_15800
SSDB
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: AWL98097
UniProt: A0A2U8PL39
LinkDB
Position
complement(3307957..3309708)
AA seq 583 aa
MTSDGVPEQFAEDKPQGFRPLNWLKRAGQFFFALSFSSLTRRIVSLNLAGLVALVASILY
LSQFRAGLIDARAQSLLVQAEIIAGAIAASATVQTNAITIDPDRLLDLKPGETYGGSDEY
SPLDFPINPERVAPVLRTLISPTKTRARIYDPNGSLLLDSRNLENVLRLDLPPPAEKPGF
VERGMVAVRTWLNRGDLPLYRELGPENGNGYAEVGDALQGQKRSMVRVNARGEVIVSVAV
PVLRSRAIHGALMLSTQGDDIDQMVTAERLAILKVGGVAAAVMIMLSLLLASTIAGPVRR
LADSAERVRRRIKARIEIPDFTRRRDEIGHLSGALRDMTSALYSRIEAIEMFAADVAHEL
KNPLTSLRSAVETLPLARNENSRARLLEVIEHDVKRLDRLISDISDASRLDAELQRQDAI
PVDLRRLLTTLVSVANETKLGHDVAVETRFEGRSPTDTFAVSGHDSRLGQVVSNLLSNAQ
SFSEPGSKVRLTCRRARSEIEIVVDDDGPGIRDDALERIFERFYTDRPHQGFGQNSGLGL
SISKQIIDAHGGRIWAENRAGPPDEEGVPTVAGARFVVRLPAL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atcacatccgacggcgttccggagcaatttgccgaagacaagccgcagggcttccgaccg
ctgaactggctcaagcgcgccgggcaattcttcttcgcgctgtccttctccagcctgacc
cgccgcatcgtctcgctcaatctcgccggcctcgtcgcgctggtggcgagcatcctgtat
ctgtcgcaattccgcgccggactgatcgacgcgcgggcgcagagcctcctggtgcaggcc
gagatcatcgccggcgcgatcgcggcctccgccacggtgcagaccaacgccatcaccatc
gatcccgaccggctgctcgacctcaagccgggcgagacctatggcggctcggacgagtac
tcgccgctggacttcccgatcaatccggagcgcgtggcgccggtgctgcgcacgctgatc
tcgccgaccaagacgcgcgcccgcatctacgatccgaacggcagcctgctgctcgacagc
cgcaacctcgaaaacgtgctgcgcctcgacctgccgccgccggcggagaagcccggcttc
gtcgagcgcggcatggtcgcggtgcgcacctggctgaaccgcggcgacctgccgctctat
cgcgagctcggccccgagaacggcaacggctatgccgaggtgggcgatgcgctccagggc
cagaaacgctcgatggtgcgggtcaatgcccgcggcgaggtgatcgtctcggtcgcggtc
ccggtgctgcgctcgcgcgcgatccacggcgcgctgatgctgtcgacgcaaggtgacgac
atcgaccagatggtcactgccgaacgcctcgccatcctgaaagtcggcggcgtcgcggcc
gccgtcatgatcatgctgtcgctgctgcttgcgagcacgatcgccgggcccgtgcgccgg
cttgccgacagcgccgagcgcgtccgccgccgcatcaaggcccgcatcgagatccccgat
ttcacccgccgccgcgacgagatcggtcatctctccggcgccctgcgcgacatgacgagc
gcgctctacagccgcatcgaggcgatcgagatgttcgccgccgacgtcgcccacgaattg
aagaacccgctgacctcgctgcgctcggcggtcgagacactgccgctggcgcgcaacgag
aacagccgtgcgcgcctgctcgaggtgatcgagcacgacgtcaagcggctcgaccgcctg
atctccgacatctccgacgccagccgcctcgatgccgaattgcagcgccaggacgcgatc
ccggtcgatttgcgccgcctgctgacgacgctggtgtccgtcgccaacgagaccaagctc
ggccacgacgtcgcggtcgagacgcgcttcgagggccgcagcccgaccgacaccttcgcc
gtgtccggccacgattcacggctcggacaagtggtctccaacctgctgtccaacgcgcag
tcgttctccgaacccggcagcaaggtgcgcctcacctgccgccgcgcgcgctccgagatc
gagatcgtggtcgacgacgacggccccggcattcgcgacgacgcgctggaacgcatcttc
gagcgcttctacaccgaccgtccgcatcagggttttggccagaactccggcctcggcctg
tcgatctccaagcagatcatcgacgcccatggcgggcgcatctgggccgagaaccgcgca
ggcccgccggatgaggagggcgtgccgacggtcgcaggcgcgcgcttcgtggtgaggctg
ccggcgctatga

DBGET integrated database retrieval system