KEGG   Bradyrhizobium ottawaense: CIT37_15900Help
Entry
CIT37_15900       CDS       T05524                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00071  Fatty acid degradation
bot00280  Valine, leucine and isoleucine degradation
bot00281  Geraniol degradation
bot00310  Lysine degradation
bot00362  Benzoate degradation
bot00380  Tryptophan metabolism
bot00410  beta-Alanine metabolism
bot00640  Propanoate metabolism
bot00650  Butanoate metabolism
bot00903  Limonene and pinene degradation
bot00930  Caprolactam degradation
bot01100  Metabolic pathways
bot01110  Biosynthesis of secondary metabolites
bot01120  Microbial metabolism in diverse environments
bot01130  Biosynthesis of antibiotics
bot01200  Carbon metabolism
bot01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CIT37_15900
   00650 Butanoate metabolism
    CIT37_15900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CIT37_15900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CIT37_15900
   00310 Lysine degradation
    CIT37_15900
   00380 Tryptophan metabolism
    CIT37_15900
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CIT37_15900
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CIT37_15900
   00281 Geraniol degradation
    CIT37_15900
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CIT37_15900
   00930 Caprolactam degradation
    CIT37_15900
Enzymes [BR:bot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CIT37_15900
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CIT37_15900
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CIT37_15900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N DAO NAD_binding_2 FAD_binding_3 F420_oxidored ApbA Pyr_redox_2 PALP NAD_binding_8 Pyr_redox Sacchrp_dh_NADP NAD_Gly3P_dh_N AlaDh_PNT_C Shikimate_DH NAD_binding_7 2-Hacid_dh_C GIDA
Motif
Other DBs
NCBI-ProteinID: AWL93477
UniProt: A0A2U8P720
LinkDB All DBs
Position
3336719..3338932
Genome map
AA seq 737 aa AA seqDB search
MTYKNFKVETDSDGIALVTWDIPGRSMNVLDETSTNELDAIVKATTADAAVKGVVITSAK
EAFCAGADLSMLEGMNQAYAKVFKEQGETAANQMLFDQSRRFSLVLRSIETSGKPWAAAI
NGLALGGGFEITLCCHYRVAAENPKTRLGLPEVKVGLFPGAGGTQRVPRLVPPQDAMTIL
LKGDPVTIEKAKALNLIHAIVPAADLIKAAKDWIKGGGKAVAPWDEKGFKLPGGPVFSKA
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTSVLRSKEAAA
MIRSLFLSMQELNKGARRPKDVPATKVKKIAVIGAGFMGASVGYVSARAGLDVVLIDRDQ
ESADKGKAHAQKVIEDQIKKGRAKPADAEALLARITPTADYAALKDVDLVIEAVFEDRKV
KADTFAKAQEHMKPDVIFASNTSTLPITSLAESFKDQGKFVGIHFFSPVEKMMLVEIIKG
KNTGDLALATALDYVRQIGKTPIVVNDSRGFFANRCVGRYVAEGNEMFLEGVPPAMIENC
AKMAGMPVGPLSLSDEVALDLGLKIMKATEADLGPNAINPDQKKLMVEMVEKQGRLGRKN
SKGFYDYPEKGKGQKSLWPGLSALQPKQLDPDTLDIEELKQRFLVVQAVEAARTVEDHVI
TDPREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHKLEAKYGSRFTPPKLLEEMA
AKGETFYGRFAPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagaatttcaaggttgagaccgattccgacggcatcgcgctcgttacctgg
gacatcccgggccgctcgatgaacgtgctcgacgagacctcgaccaacgagctcgacgcg
atcgtcaaggcgaccaccgcggatgccgcggtgaagggcgtcgtcattacctccgccaag
gaggcattctgcgccggcgccgacctgtcgatgctcgaaggcatgaaccaggcttacgcc
aaggtgttcaaggagcagggcgagaccgccgcgaaccagatgctgttcgaccagagccgc
cgcttctcgctggtgctgcgctcgatcgagacgtcaggcaagccgtgggcggccgcgatc
aacgggctcgcgctcggcggtggcttcgaaatcacgctgtgctgccactatcgcgtcgcc
gcggagaatcccaagacccgcctcggcctgcccgaggtcaaggtcggcctgttccccggt
gccggcggtacgcagcgcgtgccgcgcctggtgccgccacaggacgcgatgacgatcctg
ctcaagggcgatccggtcacgatcgagaaggcgaaggcgctgaacctgatccacgccatc
gttcccgccgccgacctcatcaaggccgcgaaggactggatcaagggcggcggcaaggcg
gtcgcgccctgggacgagaagggcttcaagctgcccggcggcccggtgttctccaaggcc
ggcatgatgatgttcccggcgggaaacgcgatctatcgccgcgagacctacgacaattat
ccggccgcgcgcgccatcatgagctgcgtctatgagggcctgcagttgccgatcgacgcc
gcgctgcgggtggagtcgcgctacttcacctcggtgctgcgctcgaaggaagcggccgcg
atgatccgcagcctgttcctgtcgatgcaggagctcaacaagggcgcgcgccgcccgaag
gacgtgcctgcgaccaaggtgaagaagatcgccgtgatcggcgccggcttcatgggcgcg
agcgtcggctacgtctcggcccgcgccggcctcgacgtcgtcctgatcgaccgcgaccag
gagagcgccgacaagggcaaggcccatgcgcagaaggtgatcgaggatcagatcaagaag
ggccgggccaagcccgcggatgccgaagcgctgctcgcgcgcatcacgcccaccgcggac
tatgcggcgctgaaggacgtcgacctcgtcatcgaggccgtgttcgaggaccgcaaggtc
aaggctgataccttcgccaaggcgcaggagcacatgaagccggacgtgatcttcgcgtcg
aacacctcgacgctgccgatcacctccctggccgagagcttcaaggaccaaggcaagttc
gtcggcatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcaagggc
aagaacaccggcgacctcgcgctcgcgaccgcgctcgactacgtccggcagatcggcaag
acgccgatcgtcgtcaacgactccagagggttcttcgccaatcgctgcgtcggccgctac
gtcgccgaaggcaacgagatgttcctcgagggcgtgccgcccgcgatgatcgagaactgc
gccaagatggccggcatgccggtcggcccgctctcgctctccgacgaggtcgcgctcgat
ctcggcctcaagatcatgaaggcgacggaggccgatctcggccccaacgccatcaatcca
gatcagaagaagctgatggtggagatggtcgagaagcagggccgcttggggcgcaagaac
agcaagggcttttacgactatcccgagaagggcaagggtcagaagagcctgtggccgggc
ctctcggccttgcagccgaagcagctcgaccctgatacgctcgatatcgaggagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcacggtcgaggaccacgtcatc
accgatccgcgcgaggccgatgtcggctccatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgtcctatatcgacttcatgggcaccaagaagttcgtcgagctctgccac
aagctggaagcgaagtacggctcgcgcttcacgccgccgaagctgctggaggagatggcg
gcgaagggcgagaccttctacggccgcttcgcgccgaagaaggcggcggcctga

DBGET integrated database retrieval system