KEGG   Bradyrhizobium ottawaense: CIT37_15910Help
Entry
CIT37_15910       CDS       T05524                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CIT37_15910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bot02000]
    CIT37_15910
Enzymes [BR:bot01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CIT37_15910
Transporters [BR:bot02000]
 Other Transporters
  Pores ion channels [TC:1]
   CIT37_15910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AWL93479
UniProt: A0A2U8P6W7
LinkDB All DBs
Position
complement(3339796..3340410)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYELVKVDIRAKKLENGEDYLKLNPKGQVPALGLDSG
EIVTEGPVIVQMIADQASSKALAPAHGSSERYKLLEWLNFLTSEVHKSFGPMFAPALNDE
AKAFFRDRVMGKLKYIDSQLAGRDYLMGKQFTVADGYLFTMLTWGERMKFDLSAMPNLAA
YKARVEARPQVQEALKKEGLAQAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtactattcgcccggtgcctgctcgctgtccccccacatcgcgctcctcgaa
gccggcctgccctatgagctggtcaaggtcgatatccgggccaagaagctcgaaaatggt
gaggactatctgaagctgaacccaaagggccaggtccctgcgctgggcctcgacagcggt
gagatcgtgaccgaaggcccggtgattgtccagatgatcgccgatcaggcatcaagcaag
gcactggcgcccgcccatggcagttccgagcgctacaagctgctggagtggctgaatttc
ctcacctcggaggtgcacaagagcttcggtccgatgttcgcgccggccctgaacgacgaa
gccaaggctttcttcagggatcgcgtcatgggcaagctgaaatatatcgacagccagctc
gccggccgcgactacctcatgggcaagcagttcacggtcgccgacggctatctgttcacg
atgctgacctggggcgagcggatgaagttcgacctctccgcgatgccgaaccttgccgcc
tacaaggcccgcgtcgaggcgcggccgcaagtgcaggaagcgctgaagaaggaaggcctc
gcgcaggcgaagtaa

DBGET integrated database retrieval system