KEGG   Bradyrhizobium ottawaense: CIT37_30270Help
Entry
CIT37_30270       CDS       T05524                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00010  Glycolysis / Gluconeogenesis
bot00020  Citrate cycle (TCA cycle)
bot00620  Pyruvate metabolism
bot01100  Metabolic pathways
bot01110  Biosynthesis of secondary metabolites
bot01120  Microbial metabolism in diverse environments
bot01130  Biosynthesis of antibiotics
bot01200  Carbon metabolism
Module
bot_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIT37_30270
   00020 Citrate cycle (TCA cycle)
    CIT37_30270
   00620 Pyruvate metabolism
    CIT37_30270
Enzymes [BR:bot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CIT37_30270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N GCV_H HlyD_2 Fas_alpha_ACP
Motif
Other DBs
NCBI-ProteinID: AWL95945
UniProt: A0A2U8PDV6
LinkDB All DBs
Position
6288225..6289580
Genome map
AA seq 451 aa AA seqDB search
MPINILMPALSPTMEKGNLAKWLKKEGDKVKSGDVIAEIETDKATMEVEAIDEGTIARIL
VPEGTQDVPVNDVIAVLAGEGEDVKAAGAAKPSASAAPPKAAEAPAAAPAPAAAPAAPKA
APSPAAAPAPQAATPAAQSNGQGGRVFSSPLARRLAKDAGIDVSMVTGTGPHGRVVARDV
EQAKSGKGLKAPAAAPSGAPSIAPTMSDKQILSLFEPGSYDIIPHDGMRRTIAQRLTASI
QNVPHFYLTIDCDIGKLLAAREEINAAAPKDKEKKPLYKISVNDFVIKAMAVALQKIPNC
NVSWTESGMVKHHHSDVGVAVAMPGGLITPIIRKAETKTLSTISNEMKDFAARARSRKLK
PEEYQGGTTAVSNLGMYGISHFTAVINPPHATILAVGTSEERPVVRGGKIEIAHMMSVTL
SCDHRAIDGALGAELIGAFKQLIENPVMMMV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcaacatcctgatgcccgctctctcgccgacgatggagaagggcaacctcgcc
aagtggctgaagaaggaaggcgacaaggtcaaatccggcgacgtcatcgccgagatcgag
accgacaaggcgaccatggaggtcgaggccatcgacgagggcacgatcgccaggatcctg
gtgcccgagggcacgcaggacgtcccggtcaacgacgtgatcgcggtgctcgccggcgaa
ggcgaggacgtgaaggcggcgggtgccgccaagcccagcgcttcggccgcacctccgaag
gcggccgaggctcctgctgcggcgccggctcccgcagctgcgcctgccgcgcccaaagcc
gcgccgtcgccggctgctgcacctgcgccgcaggccgctactccggccgcgcagagcaac
ggccaaggtggtcgcgtgttctcctcgccgctggcgcggcgtctcgccaaggacgccggc
atcgacgtgtcgatggtaacaggcaccggcccgcacggccgcgtggtcgcccgcgacgtc
gagcaggccaagtcgggcaagggcctcaaggcgcccgccgcggcaccatcaggtgcgccc
tcgatcgcgcccaccatgtcggacaagcaaatcctgtcgctgttcgagcccggctcctac
gacatcattccgcatgacggcatgcgccgtaccattgcgcagcgcctgactgcatcgatc
cagaacgtcccgcacttctacctgaccatcgactgcgacatcggcaagctcctcgctgcc
cgcgaggaaatcaacgctgccgcgccgaaggacaaggagaagaagccgctctacaagatc
tcggtcaacgacttcgtcatcaaggcgatggcagtggcgctgcagaagatcccgaactgc
aacgtcagctggaccgaaagcggcatggtcaagcaccatcattccgacgtcggcgttgcg
gtcgcaatgccgggtggcctgatcaccccgatcatccgcaaggccgagaccaagacgctt
tcgaccatctccaacgagatgaaggatttcgccgcgcgcgcccgctcgcgcaagctcaag
cccgaggaataccagggcggcaccaccgcagtttccaacctcggcatgtacggcatcagc
cacttcaccgccgtgatcaacccgccgcatgcgaccatcctcgcggtcggcaccagcgag
gaacgccctgtggtacgcggcggcaagatcgagatcgcgcacatgatgagcgtgaccttg
tcctgcgatcaccgcgccatcgacggtgcgctcggcgccgagctgatcggcgccttcaag
cagctgatcgaaaaccccgtcatgatgatggtctga

DBGET integrated database retrieval system