KEGG   Bradyrhizobium ottawaense: CIT37_33910Help
Entry
CIT37_33910       CDS       T05524                                 

Definition
(GenBank) sulfite exporter TauE/SafE family protein
  KO
K07090  uncharacterized protein
Organism
bot  Bradyrhizobium ottawaense
Brite
KEGG Orthology (KO) [BR:bot00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CIT37_33910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AWL96567
UniProt: A0A2U8PGX0
LinkDB All DBs
Position
7021459..7022241
Genome map
AA seq 260 aa AA seqDB search
MSGIHDLLAGAGVGLVSGLTSGLMGTSPGGGLVIFSVLLLGAEQHVAQGTSLITQVPPTG
LAGARRYWQSGNRSPWPWIVWIGIGFLVGGAGGGYAAAAVSDRVLQWTYVIYLAALIALL
ILRRDRKDGGREADDQDQQPRLPLLLIGLLAGFSSGFMGIGGGLAITVGLAAGLRVPQHQ
AQLVSLVFSVIPTNLPAAWIYWSKGLLVGWPAITGILAGLWIGTDLGARLANGVSKSVLR
RVMIAFVSLMALYMTYKALT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaatccacgacctgctcgctggcgccggcgtcggcctggtcagcggattgacg
tcgggcttgatgggaacgagcccgggtggcgggctcgtgatcttcagcgtgctgctgctc
ggcgcggaacagcacgtcgcgcaagggacgtcgctgatcacacaggtcccgccgacgggc
ctcgccggcgcgcgccgctactggcagagcggcaatcgcagcccctggccgtggatcgtc
tggatcggcatcggatttctcgtcggcggtgccggcggcggttacgccgcggcggcggtt
tccgaccgggtcttgcaatggacttatgtcatctatctcgccgcgctgatcgccctgctg
atcctgcgtcgcgatcgcaaggacggcggccgtgaggccgacgaccaggaccagcagccc
cggctacccctgctgctcatcggcctgctcgccggattttcctccggcttcatgggcatc
ggcgggggcctggccatcacggtcggccttgctgcgggcctgcgcgtgccgcagcatcag
gcgcagctcgtcagcctcgttttctcggtcatcccgaccaacctgccggcggcctggatc
tactggagcaagggcctgctggtcggctggccggccatcacaggtattctggcaggcctc
tggatcggcaccgatctcggcgcacgcctggccaatggcgtcagcaaatcggtgctgcgc
cgggtcatgatcgccttcgtctcgctgatggcgctctacatgacgtacaaggcgctgacc
tga

DBGET integrated database retrieval system