KEGG   Bradyrhizobium ottawaense: CIT37_35960Help
Entry
CIT37_35960       CDS       T05524                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00040  Pentose and glucuronate interconversions
bot00051  Fructose and mannose metabolism
bot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CIT37_35960
   00051 Fructose and mannose metabolism
    CIT37_35960
Enzymes [BR:bot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CIT37_35960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AWL98463
UniProt: A0A2U8PL44
LinkDB All DBs
Position
complement(7447983..7449002)
Genome map
AA seq 339 aa AA seqDB search
MRAAVLQDIRDIRVLDIPEPKPLAEDELIIRVKAVGVCGSDLHSYLEGGTTGPTQVRPFV
LGHEFSGVLTPDSARKAGFSADALVAVDPSIPCGRCEWCHRGHTNLCPNVKFLGYAPHNG
AMAEFVCVPRSAVHLVPDSIDPAGAAILETLGVAIHAMDLARPRLLESVAVLGCGPVGLL
LVQLARLAGSGKIIAIDPVEQRTALACDLGADVACRSYAEVGDATEGRGVDLVIEATDSS
HGFEHAARCARIGGRVVLVGIPENNQYVLSGAESRRKGLSIKFSRRMPEVYPRAIALAQG
GQVKLAPLATHRFSLDQTPAAFEQQVARRDGIIKAIICP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcggtgctccaggacattcgtgacatccgagtcctcgatatccccgagccg
aagccgctcgcggaggacgaactcatcatccgcgtcaaggctgtcggcgtttgcggcagc
gatttgcattcctatctcgagggcggaacaactggcccgacccaagtcaggccgttcgtc
ctgggccatgagttctcgggtgtcctcacgccggactcggcgcgaaaagcggggttctcg
gccgacgcgttggtggcggtcgatccttccattccctgcggccgttgcgaatggtgtcac
cgcggtcacaccaatctctgccccaacgtgaaattcctgggctacgcgcctcacaacggc
gccatggccgaattcgtctgtgtgccccgatccgccgtgcatctggtgcctgacagcatc
gacccggccggcgcggcgatcctggagacgcttggcgtcgcgatccatgcgatggatctg
gcgcgcccgcggcttctggaaagcgtggcggtgctcggctgcgggccggtgggattgctg
ctcgtgcaactggcgcggcttgcaggtagcggaaagatcatcgcgatcgaccccgtcgag
cagcgtactgcactggcctgcgacctcggggctgacgtggcgtgccgcagctacgccgag
gtcggggacgccaccgaaggccgcggcgtcgatctggtgatcgaggcaaccgactcatcg
cacggcttcgagcatgcggcccgctgcgcccgcatcggtggccgggtcgtcctcgtcggc
atcccggagaataatcagtacgtcctcagcggcgcggagtcgcgtcgaaagggcctgtcg
atcaagttttcacggcgcatgccggaagtttatccgcgcgccatcgcgcttgcgcaaggc
gggcaggtcaagctggcgccgctggccacgcatcgtttctcgctcgaccagacgcctgcc
gcgttcgagcagcaggtcgcgcggcgcgacggcatcatcaaggcgatcatctgcccgtag

DBGET integrated database retrieval system