KEGG   Bradyrhizobium ottawaense: CIT37_38810Help
Entry
CIT37_38810       CDS       T05524                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bot  Bradyrhizobium ottawaense
Pathway
bot00620  Pyruvate metabolism
bot00680  Methane metabolism
bot00710  Carbon fixation in photosynthetic organisms
bot01100  Metabolic pathways
bot01120  Microbial metabolism in diverse environments
bot01200  Carbon metabolism
Module
bot_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIT37_38810
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CIT37_38810
   00680 Methane metabolism
    CIT37_38810
Enzymes [BR:bot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CIT37_38810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SinI
Motif
Other DBs
NCBI-ProteinID: AWL97412
UniProt: A0A2U8PI25
LinkDB All DBs
Position
complement(8099477..8102269)
Genome map
AA seq 930 aa AA seqDB search
MSLQTAPSDSAEHRANRPEDVQALEADARLRDDIRLLGRILGDTVRDQEGAELFDLVERI
RQTSIRFHRDEDRLARRELEQILDSMSTSETVRIVRAFSYFSHLANIAEDQNNIRQMRAR
SAGKSSGVLAETLAHARDAGIKPDQLRSFFKSALVSPVLTAHPTEVRRKSTMDREMEVAG
LLDRRERVALTAEEADASDEQLRREVLTLWQTNLLRRTKLTVLDEVANGLSFYDYTFLRE
VPRLVNALEDRLEEGGEQAASELASFLRMGSWIGGDRDGNPFVTADVMRGTLRLQSSRVM
QFYLEELHVLGSELSIAAHLADVSEELRNLAERSPDTSPHRSGEPYRLAVSGIYARLTAT
AEKLAVEITRRPVGKGAPYASVKELQADLDVLHRSLISNNARVIARGRLRLLRRAVDCFG
FHLARLDIRQNSAVHERTIAELMDAANPGMSYLALGEEARISLLTNELRSTRALVSPFVK
YSDETMGELNVFHAAAEAHAMFGSDAIPQCIISMCKGMSDMLEVAVLLKEVGLVHPSGRS
AINIVPLFETIEDLQASSGIMDRMLSLHDYRRLVDSRGSVQEVMLGYSDSNKDGGFVTSG
WELYKAEINLVEVFERHHVRLRLFHGRGGSVGRGGGPSYDAIIAQPGGAVNGQIRITEQG
EIISSKYSNAEVGRNNLEILAAATLEASLLHPRQSAPRREYLTAMDELSNLAFKAYRGLV
YETDGFVDYFWSSTVINEIATLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRLMLPGWY
GFGSAVEQWITEHPDKGMPFLKELYREWPFFRMLLSNMDMVLAKSSIAIASRYAELVPDE
ALREKIFGRIRREWHSCIETLLDIMGQDRLLQGNPLLERSVRHRFPYLDPLNHVQVELLK
EHRAQNPDEQVLRGIQLTINGISAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccagaccgcaccatccgacagcgccgagcatcgcgccaaccgccccgaggac
gtccaggcgctggaggccgatgcgcggctgcgggacgacatccgcctgctcgggcgcatc
ctcggcgacaccgtgcgcgatcaggagggcgccgaattgttcgacctggtcgagcgcatc
cgccagacctcgatccgcttccaccgcgacgaggaccggctcgcccgccgcgagctcgag
cagatcctcgacagcatgtcgacctccgagacggtgcggatcgtccgcgccttcagctat
ttctcccacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgggctcgc
agcgcaggcaagagctccggcgtgctggcggaaacgctcgcccatgccagggacgccggc
atcaagcccgatcagctccgcagcttcttcaagtccgcgctggtcagcccggttctgacc
gcgcatccgaccgaagtccgccgcaagagcactatggaccgcgagatggaggtcgccggc
ctgctcgaccgccgcgagcgcgtggcgctgaccgcggaggaggccgatgccagcgacgag
cagctgcgccgcgaggtgctgacgctctggcagaccaatctcttgcgccgcaccaagctc
accgtgctcgatgaggtcgccaacggcctgtcgttctacgactacaccttcctgcgcgag
gtgccgcggctggtcaacgccctcgaggaccggctggaggagggcggcgagcaggcggct
tccgagctcgcctcgttcctgcgcatgggcagctggatcggcggcgaccgcgacggcaat
cccttcgtcaccgccgacgtcatgcgcggcacgctgcggctgcagtcgagccgggtaatg
cagttctatctggaagagctgcacgtgctcggctcggaattgtcgatcgcggcgcatctt
gccgacgtctccgaggagctgcgcaacctggcggaacgctcgccggatacctcgccgcac
cggagcggcgagccttatcgtctggcagtctccggcatctacgcgcgcctgaccgcgacg
gcggaaaagctcgcggtcgagatcacgcgccggccggtcggcaagggcgcgccatatgcg
agcgtgaaggagctgcaggccgatctcgacgtgctgcaccgctcgctgatctccaacaat
gcccgcgtcatcgcccgcggccggctgcggttgctgcggcgcgcggtggactgcttcggc
ttccatctcgcccggctcgacatccgccagaactcggcggtgcacgaacgcaccatcgcc
gagctgatggacgccgccaatcccggcatgtcctatctcgcgctcggcgaggaggcgcgc
atctcgctgctgaccaacgagctgcgctcgacgcgcgcgctggtctcgcccttcgtcaag
tacagcgacgagaccatgggcgagctcaacgtcttccatgccgccgcggaagcgcatgcg
atgttcggctcggacgccattccccaatgcatcatctcgatgtgcaagggcatgtccgac
atgctcgaggtcgcggtgctcctgaaggaggtcggcttggtccatccctctggccgcagc
gctatcaacatcgtgccgctgttcgagaccatcgaggatctgcaggcctccagcggcatc
atggaccgcatgctgtcgctgcacgattaccgccgcctggtcgacagtcgcggcagcgtg
caggaggtcatgctcggctattccgacagcaacaaggacggcggcttcgtcacctcgggt
tgggagctctacaaggccgagatcaacctcgtcgaagtgttcgagcggcatcacgtgcga
ctgcgcctgttccatggccgcggcggctcggtcggccgcggcggcggtccgagctatgat
gccatcatcgcgcagcccggcggcgccgtgaacggtcagatccgcatcaccgagcagggc
gagatcatctcgtcgaaatattccaacgccgaagtcggccgcaacaatctggaaatcctc
gcggcggcgacgcttgaagcaagtctcttgcatccgcgccagagcgcgccgcgccgcgaa
tatttgaccgcgatggacgaattgtcgaacctcgccttcaaagcctatcgcggcctcgtc
tacgagaccgacggcttcgtcgattatttctggtcctcgaccgtcatcaacgagatcgcg
acgctgaacatcggcagccgtccggcctcgcgcaagaagacccgggcgatcgaggatctg
cgcgccatcccctgggtgttttcatgggcgcagtgccggctgatgctgccgggctggtac
ggctttggcagcgcggtcgagcagtggatcactgaacatcccgacaagggcatgccgttc
ctgaaggagctctacagggaatggccgttcttccgcatgctgctctcgaacatggacatg
gtgctcgccaaaagctcgatcgcgatcgcctcgcgctatgccgagctggtgcccgacgaa
gccttgcgcgaaaaaatattcggccgcattcgccgcgaatggcattcctgcatcgagacg
ctcctggacatcatggggcaggaccggctgctgcagggcaatccgctgctggagcgctcg
gtgcgccaccgctttccctatctcgacccgctcaaccacgtgcaggtcgagctcttgaag
gagcatcgcgcgcagaaccccgacgagcaggtgctgcgcgggattcaactgacgatcaac
ggcatttcggcggggctgaggaatacggggtag

DBGET integrated database retrieval system