KEGG   Brucella ovis: BOV_0087Help
Entry
BOV_0087          CDS       T00534                                 

Gene name
pat
Definition
(GenBank) phosphinothricin N-acetyltransferase
  KO
K03823  phosphinothricin acetyltransferase [EC:2.3.1.183]
Organism
bov  Brucella ovis
Pathway
bov00440  Phosphonate and phosphinate metabolism
bov01110  Biosynthesis of secondary metabolites
bov01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bov00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BOV_0087 (pat)
Enzymes [BR:bov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.183  phosphinothricin acetyltransferase
     BOV_0087 (pat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_4 Acetyltransf_1 Acetyltransf_3 Acetyltransf_7 Acetyltransf_10 Acetyltransf_6 FR47 Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ABQ61144
UniProt: A0A0H3AQB6
LinkDB All DBs
Structure
PDB: 

Position
I:95142..95681
Genome map
AA seq 179 aa AA seqDB search
MPVIRDFQPADIETITAIYTQAVLTGTGSYEIEPPTMDEMAKRFAAFADQSFPILVAEAD
GRVLGYAYASYFRVRPAYRWLAEDSIYIAPDAKGQGIGKLLLRELIARISALGFRQLLAV
IGDGEHNIGSVKLHESLGFTHCGRIEGSGFKHGRWLDTVLMQLPLNGGRSTEPGPSPLS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcattcgtgatttccagcctgccgatatcgaaaccatcaccgccatctatacg
caagccgtgctgaccggcaccggctcctatgagatcgagccgccgacaatggacgaaatg
gcaaagcgttttgcggcatttgcggaccagagctttccgatcctcgtcgcggaggcggat
ggccgggttctgggctatgcctatgcgagctatttccgcgtcaggccagcctatcgctgg
cttgccgaggattcgatctatatcgcccccgatgcgaaggggcagggcattggcaagctt
ctgctgcgcgaactcatcgcgcggatttccgcccttgggtttcgccagttgctggcagtg
atcggcgacggcgaacacaatattggctcggtgaagctgcatgaaagcctgggctttacc
cattgcggacgcatcgagggttcgggcttcaagcacggacgctggctggacactgtgctg
atgcaattgccgctcaatggcgggcgttcaacggaaccgggaccatcgccgctttcataa

DBGET integrated database retrieval system