KEGG   Brucella ovis: BOV_1163Help
Entry
BOV_1163          CDS       T00534                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bov  Brucella ovis
Pathway
bov00730  Thiamine metabolism
bov00790  Folate biosynthesis
bov01100  Metabolic pathways
bov02020  Two-component system
Module
bov_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BOV_1163 (phoA)
   00790 Folate biosynthesis
    BOV_1163 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BOV_1163 (phoA)
Enzymes [BR:bov01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BOV_1163 (phoA)
Exosome [BR:bov04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BOV_1163 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bov00537]
 Enzymes
  BOV_1163 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: ABQ60078
UniProt: A0A0H3ANQ7
LinkDB All DBs
Position
I:1181386..1182750
Genome map
AA seq 454 aa AA seqDB search
MMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITAAFRDQIRKGPARNVILLIGDGMGDS
EITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDKESGKPNYVTDSAASGTAWATGVKTY
NGAIGVDIHDKPHKTLIELAKEKGTGNVSTAELQDATPAVQVAHVTHRKCYDPTSTAEKC
KDNTLENGGPGSISEQLLNTRPDVTLGGGAKYFEDKARAGTWKGQTLSAQAEARGYQLVR
NADALSKVETANQDKPVLGLFSPGNMPVRWKGPQAAHHGNLDREPVKCKVNEKRTADIPT
LVQMTEKAIDLLKTNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQAALDFARK
DGNTLVIVTADHAHASQIIDPDAKAPGLSQALKTEDGAIMGVTYGNSDEADDQGHTGAQL
RIAAFGPGAANFTGLTDQTDMFYTIRDALQLQAE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgatggcccagtctgaaactgcggctccactcttccagcgcagcgcaaaaggcgacctg
tcggcagcaggcggcgcacgccgccttgatggtgatattaccgcagcttttcgcgatcag
atcaggaaggggcctgccagaaacgtcatcctgctgatcggagacggcatgggcgattcc
gagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcatttcaagggcatcgat
gcccttcccgttaccggccagtacacccattattcgctcgacaaggaaagcggcaagccg
aattacgtgactgattctgccgcctccggcaccgcctgggccactggcgtcaaaacctat
aacggcgccatcggcgtcgatattcatgacaaaccgcacaaaacgctcattgaactcgcc
aaggaaaagggcaccggcaatgtcagcactgccgaattgcaggatgccacacccgccgtg
caggttgcccatgttacccatcgcaagtgctacgacccaaccagcacggcggaaaagtgc
aaggataatacgcttgaaaatggcggcccaggctcgatcagcgaacagcttttgaacacc
cgcccggacgtgacattgggcggcggcgcaaaatatttcgaggacaaggcccgggctggc
acatggaaaggccagaccttgagcgcacaggccgaagcacgcggctatcaactggttaga
aatgccgacgcattgagcaaggtcgagacagccaatcaggacaaacctgttctcggcctc
ttctcaccgggcaacatgccggtccgctggaaagggcctcaggccgcccatcacggcaat
ctcgacagagagcctgtcaagtgcaaggtcaatgagaagcgcactgccgatattccgaca
ctggtgcaaatgaccgagaaagccatcgacctgctgaaaaccaacgaaaaaggctttttc
cttcaggtggaaggtgcctccatcgacaaacaggaccatgccgccaatccgtgcgggcag
atcggcgaaacagtcgatctggatgaagccgtgcaggccgcactcgattttgcccgcaaa
gacggcaacacgcttgtcatcgtaacggccgatcacgcccatgcaagccagatcattgat
cccgatgcgaaggctccgggtttgagccaggcattgaaaaccgaggatggcgcgatcatg
ggcgtgacctatggcaattccgacgaagccgacgatcagggccacacaggcgcgcaattg
cgcatagccgcctttggccccggcgctgccaattttaccggcctcacggatcagacggat
atgttctacacgatccgcgatgccttgcagttgcaggcggaataa

DBGET integrated database retrieval system