KEGG   Brucella ovis: BOV_1358Help
Entry
BOV_1358          CDS       T00534                                 

Gene name
tcaB
Definition
(GenBank) drug resistance transporter, Bcr/CflA family
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bov  Brucella ovis
Brite
KEGG Orthology (KO) [BR:bov00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bov02000]
    BOV_1358 (tcaB)
Transporters [BR:bov02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    BOV_1358 (tcaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ABQ61491
UniProt: A0A0H3AS48
LinkDB All DBs
Position
I:complement(1361479..1362690)
Genome map
AA seq 403 aa AA seqDB search
MASSLVRNAIVLGLLSAIGPFAIDMYLPALPTIATDLRAETGAVQMSLLAFFLALALAQL
FCGPLSDMVGRKLPLYGGLVLFAIGSIGSALAANIDVLVLFRFVQGLGAAAGMVIPRAIV
RDLHTGVEAARLMSLLMLVFSISPILAPLTGSIIISFFGWRGVFWAVLLAAGIGIILVAT
AQKETCSVEARLESNISSALRGYGRLLKDRHFLGLVFVGGFGLASLFVYLANSAFVLIDH
YGLTPIQYAVAFSANAVSFFGVSQLNGWLGARFGLGRVMRFAACGFAAAMLAMFAAALMG
HQSLWLVASFLFVGYGFLGLVIPATAVLALEEHGEITGTASALMGTLHFVIGGVAIGIVG
AYSDGTALPMIGGITGCALAAFVLAQIVLARKSRKRGRATAAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtcttgtgcgcaatgccattgttcttggccttctttcggccatcggtcct
tttgcgattgatatgtatctaccggccctgccgaccattgccaccgatctgcgggcggaa
accggcgcggtgcagatgagcctgctcgccttctttctggcactggcgctggcgcagctt
ttctgcgggcccctgtccgatatggtcgggcgtaaactgccgctttatggcgggctggtg
ctcttcgccataggcagcatcggttcggcgcttgcggccaatatcgacgtgctggtgctg
ttccgtttcgtccagggattgggggctgcggcaggcatggtgataccgcgcgccatcgta
cgcgatcttcatacgggtgtcgaggccgcgcgccttatgtcgcttttgatgctggtcttt
tcgatttcgccgattctggccccgttgactggctccatcatcataagctttttcggctgg
cgcggggttttctgggccgtgttgcttgccgccggcatcggcatcatactggttgcgacc
gcgcagaaggaaacgtgcagcgtcgaggcgcggcttgagagcaatatcagcagcgcattg
cgcggttacgggcggctgttgaaggaccgtcatttcctcggcctcgtcttcgtgggcggt
ttcggtcttgcgtccttgttcgtttatctggcgaattccgccttcgtgctgatcgaccat
tatggcctgacaccgatacaatatgccgtggcattttccgccaatgccgtgtcgttcttc
ggcgtttcgcagctcaacggctggcttggcgcgcgtttcggccttggccgggtgatgcgc
tttgctgcttgcggctttgccgcagcaatgcttgccatgttcgcggcggcgctgatgggg
catcaatcactctggctggtcgcaagcttcctctttgtcggttacggcttccttgggctg
gttattccagctacggcggtgctggcgctcgaagaacacggcgagattaccggaacggca
tctgcattgatgggcacgcttcacttcgtcattggtggcgtggcgattggtattgtcgga
gcctattccgatggcacggcgctgccgatgattggcggcatcaccggctgtgcgctggcg
gcgttcgtgctggcgcagatcgtccttgcccgcaagtcgagaaagcgcggcagagcaacg
gcggcagcctga

DBGET integrated database retrieval system