KEGG   Bordetella sp. HZ20: DBV39_04780Help
Entry
DBV39_04780       CDS       T05532                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
boz  Bordetella sp. HZ20
Pathway
boz00250  Alanine, aspartate and glutamate metabolism
boz00410  beta-Alanine metabolism
boz00430  Taurine and hypotaurine metabolism
boz00650  Butanoate metabolism
boz01100  Metabolic pathways
boz01110  Biosynthesis of secondary metabolites
boz01120  Microbial metabolism in diverse environments
boz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:boz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DBV39_04780
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DBV39_04780
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DBV39_04780
   00430 Taurine and hypotaurine metabolism
    DBV39_04780
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DBV39_04780
Enzymes [BR:boz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DBV39_04780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AWB33138
UniProt: A0A2R4XH32
LinkDB All DBs
Position
1077236..1078633
Genome map
AA seq 465 aa AA seqDB search
MNDTSDNRNASAFDDVYASQELSRSLPKSRFPQREENPRNVFNAVRDELMLDGNSRQNLA
TFCQTWVDDEIQELMALSIDKNMIDKDEYPQTAEIERRCVAMLADLWNSPEAETTLGCST
IGSSEAAMLGGLALKWQWRNKRKAQGKSTDRPNLVCGPVQICWHKFARYFDVELREIPLE
GDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKAVHDALDKLQADTGLDIPIHVD
GASGGFLAPFCAPDIEWDFRLPRVKSINSSGHKFGLAPLGAGWVVWREAKDLPEDLIFNV
NYLGGNMPTFALNFSRPGGQVIAQYYNFLRLGREGYAKIHNACYATAQYLAAEIAKMGPF
EILFDGDSQKGIPALAWKLKEGAAIGGYTLYDLADRLRSRGWQVPAYSMPAQREDLVVQR
ILVRHGVSMDLASLLLDDMRRALDYFEKHPVTTPLSKEEGSGYSH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacacgtctgacaatcgcaacgcatcggcgttcgatgacgtttacgcttctcag
gaactgtcccgaagcctgcccaagagccggtttccgcaacgcgaagagaatccgcgcaat
gtgtttaatgccgtacgcgacgagttgatgcttgacggcaattcacgccagaatctcgct
acgttttgtcagacatgggttgatgacgaaatccaggagttgatggcactttcgatcgac
aaaaacatgatcgacaaggacgagtacccacaaaccgcggagatcgaacgtcgctgcgtg
gccatgctggctgacctctggaactcaccagaagcggaaacaacccttgggtgctcgacc
atcggctcttcggaagcggccatgctcggcggcctggccttgaaatggcagtggcgtaac
aaacgcaaggcacaaggcaagtccaccgatcgtcccaatctggtctgcggaccagttcag
atctgctggcacaagttcgcccgctatttcgatgttgaattgcgtgagattccgcttgaa
ggtgatcgcctgatcatgagcccggaagaagtacttaagcgcgtcgacgaaaacacaatt
ggtgtggtgcctacgttaggagtgactttcacatgccagtacgaacccgtcaaagcagtg
cacgatgcactggacaagttgcaggccgatactggtctggatattccgattcacgtcgat
ggcgccagcggcggcttcctggcaccgttttgcgcacctgacattgagtgggatttccgt
ttgccacgggtcaaatccatcaactcgtcaggtcacaagttcggtctggcgccgctgggt
gcgggctgggtcgtctggcgtgaggccaaggatctgcccgaagatctgatcttcaacgtc
aactacctgggtggcaacatgcccacgtttgcgttgaacttctcgcgaccaggcgggcag
gtgattgctcagtactacaacttcctgcgacttggacgtgaaggctacgccaaaatccac
aacgcatgctatgcgaccgcccagtacctcgcggccgagattgccaaaatgggcccattc
gagattctgtttgacggcgacagtcagaaaggaattcccgcgctggcctggaagctcaag
gaaggtgctgccatcggtggctacacgctctacgatctcgccgatcgtcttcgcagtcgt
ggctggcaggtcccggcctactcgatgcccgctcagcgtgaggatctggtggttcagcgg
atcctggttcgccacggcgtcagcatggatctggcctctctgctgctggatgatatgcgc
cgcgcactggattacttcgagaagcatccagtgacaacgccgttgtctaaagaagaaggt
agtggctacagccactga

DBGET integrated database retrieval system