KEGG   Bordetella sp. HZ20: DBV39_06755Help
Entry
DBV39_06755       CDS       T05532                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
boz  Bordetella sp. HZ20
Brite
KEGG Orthology (KO) [BR:boz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DBV39_06755
Enzymes [BR:boz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DBV39_06755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin FAD_binding_3 FAD_oxidored K_oxygenase Thioredoxin_9 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AWB33456
UniProt: A0A2R4XI11
LinkDB All DBs
Position
1509580..1511160
Genome map
AA seq 526 aa AA seqDB search
MLDDNLKTQLKAHLERVTQPFEMVATLGEDEKSQELLALLQDINGLSDKITLRTDGQASR
KPSFRLNRIGSDMGVEFAAIPLGHEFTSLVLSLLWVGGHPPKIEADVIEQIKSLDGEYQF
EIYMSLSCHNCPDVVQALNVMAVLNPRIRVVTIDGALFQDEVNEREVMAVPTVFLNGQMF
ESGRMGVEEIVARLDTNSAAREAEKLNARDPYEVLIIGGGPAGAAAGVYAARKGIRTGIA
AERFGGQVNDTNAIENYISILETDGPKFAQALEAHVKAYEVDVMNLQTAEKLVPGEEPGD
LIEVHMTNGGVLKSRSVILSTGARWRNVNVPGEAEYRNKGVAYCPHCDGPLFKGKRVGVI
GGGNSGVEAAIDLAGIVGHVTLLEFAENLRADAVLISKLKSLPNVEVITNAQTTEFTGTN
GKLDGLNYKDRTTGESHRVEMEGVFIQIGLVPNTEWLKGTLELSKYGEIVVDARGATSIP
GVFAAGDATTVPYKQIVIAAGDGSKAALSAFDYLIRTPAPVTAVSA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgataacttaaagactcaactcaaagcccacctggaaagggtgacccagcca
ttcgagatggttgccacactcggcgaggacgagaaatcgcaggagttgctggcgctgctg
caagacattaacggtctgtccgacaagatcacactgcgtacagacggtcaggcttcgcgc
aaaccatcctttcgcctgaatcgaatcggttcggacatgggagttgagttcgcagcgatc
ccgcttggccacgaatttacttcactggtcctgtcgctactctgggttggcggtcacccc
ccaaaaatcgaggccgacgtcattgagcagatcaagtcgctcgatggagagtaccagttc
gaaatttacatgtcgctgagctgccacaactgccctgatgtggttcaggcactcaacgtc
atggctgtactgaaccccaggatccgcgttgttacgatcgacggtgccctcttccaggat
gaggtcaacgagcgcgaggtaatggctgtaccgacggtattcctgaacggacagatgttc
gaatcaggccgaatgggtgtggaagagatcgtcgcccgtctcgacacaaactcagctgct
cgcgaagccgagaaactcaacgccagggatccatatgaagtcctgatcataggcggcggt
ccagccggagctgcagcgggcgtatatgccgctcgcaaaggaatacgaacgggcatcgca
gccgagcgtttcggcggacaagtcaacgacacgaacgcaatcgagaactacatttcgatt
cttgagacagatggcccgaagtttgcacaggcactcgaagcccacgtcaaggcgtacgaa
gtcgacgtcatgaatttgcagactgcagaaaaactggtcccaggcgaggagccaggtgat
ctgatcgaagtacacatgaccaacggtggtgtgctcaagtcccgcagtgtgatcctctcg
accggtgcacgctggagaaacgtcaacgtacctggcgaagccgagtatcgcaacaagggg
gtggcttactgcccgcattgcgatggtccactcttcaaaggcaagcgtgtaggcgtgatc
ggtggtggcaactctggcgttgaagcagcgattgacctggctggaattgtaggtcacgtc
actttgctagagtttgcagagaatctgcgtgccgatgcggttcttatcagcaagctcaag
agcctgcccaacgttgaggtcatcaccaacgcccagacaaccgagtttaccggaaccaac
ggcaaacttgatggcctgaattacaaggatcgtacaaccggcgagagccatcgcgtcgag
atggaaggagtatttatccagattggactggtgcccaacaccgaatggctcaagggcacc
ctcgagttgagcaagtatggtgagattgtcgtggatgcgcgcggcgccaccagcatacct
ggtgtatttgcagcgggcgatgccaccacagtcccatacaagcagatcgtcatcgctgcg
ggcgatggatccaaagctgccctaagcgcctttgactacctcatccgcaccccggcaccg
gtgacagctgtctctgcctga

DBGET integrated database retrieval system