KEGG   Bordetella sp. HZ20: DBV39_08675
Entry
DBV39_08675       CDS       T05532                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
boz  Bordetella sp. HZ20
Pathway
boz03030  DNA replication
boz03430  Mismatch repair
boz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:boz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DBV39_08675
   03430 Mismatch repair
    DBV39_08675
   03440 Homologous recombination
    DBV39_08675
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:boz03032]
    DBV39_08675
   03400 DNA repair and recombination proteins [BR:boz03400]
    DBV39_08675
Enzymes [BR:boz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     DBV39_08675
DNA replication proteins [BR:boz03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     DBV39_08675
DNA repair and recombination proteins [BR:boz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     DBV39_08675
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AWB33768
UniProt: A0A2R4XJ11
LinkDB
Position
1938889..1939329
AA seq 146 aa
MRVDFAFDAHDRIAQAVRTTEKQVTRGNRVLVYTTDLARLKRYDRALWSLPGATFLAHDI
LSEDAPPDLPVYLIQDQTGCNLARPLLANGFWLLNLHDECPPLEQPVTRILEIVSSDDDD
RALARNRWRSYQQAGYRLHAHQLPSD
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcgggtggatttcgcgtttgatgcgcatgaccggattgcacaggctgtgcgcaccact
gaaaagcaagtcacccggggaaaccgggtgcttgtgtacacaaccgatctggcccgactc
aagcgctatgacagagcgctatggagtctgccaggggcgacatttcttgcgcatgacatc
cttagtgaggatgcaccacccgacttgccggtctatctgattcaggatcaaaccgggtgc
aacctggcgcgcccccttctggcaaacgggttctggcttctcaatctgcatgacgagtgc
ccacccctggagcaaccggtcacaaggattctggaaatcgtgagcagtgatgatgatgat
agagccctggcgcggaatcgctggcggtcatatcaacaggctggataccgccttcacgca
catcagctaccatcggactaa

DBGET integrated database retrieval system