KEGG   Bordetella sp. HZ20: DBV39_11010Help
Entry
DBV39_11010       CDS       T05532                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
boz  Bordetella sp. HZ20
Pathway
boz00564  Glycerophospholipid metabolism
boz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:boz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DBV39_11010
Enzymes [BR:boz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DBV39_11010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like FAD_binding_3 NAD_binding_8 GIDA K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AWB34148
UniProt: A0A2R4XK43
LinkDB All DBs
Position
2419669..2421276
Genome map
AA seq 535 aa AA seqDB search
MSNKTVKPALATDRASLIKQTQSEVPFDMVVIGGGATGLGTALDAVTRGYRVALFEKFDF
AKGTSSRSTKLVHGGVRYLAQGNISLVKEALHERSTVLNSAPHLAQPLGFLMPCYKTWQV
PFYWTGLRLYDTLSGRHSLGKTEILNAGKTRSLLPNVLSSGLVGSVKYWDGQFDDARLAL
AIARTAQQEGATLLNYCEVVSIEHFQDKVSGVVVKNTESGQTWQVKSSCIVNATGVWVDS
LRKMDDHAAGREPRKMVAPSQGVHIVVDRSFMSSDHALIVPKTADGRVLFAVPWLGKVIL
GTTDTARDQPLTEPQALKSELDFILKESAAHLQKAPAVQDIRSIWVGLRPLVRPQNTNEG
NTKSISREHTIISSATGLVTVTGGKWTTYRVMAKDTVNHCIKAGVLADRATVCTTDTLRL
VGAQSGRRMTQPISQAPGLSIYGDERDQVEATEGAHNQLAEGLTEAMVRFAARYEYARTV
EDVLARRCRMLFLDAALATQCAPQVAQILQSETGIDPQLDAFLSLAEHYRTIPYL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaagacagtcaaaccagcactcgccacagacagggccagtcttatcaagcag
actcagtccgaagtgccattcgacatggtcgtcatcggtggtggtgcaacaggtctgggt
acggcactggatgcagtcactcgaggatacagggtagccttgttcgagaagtttgacttt
gcaaaaggcacctcatctcgctcgaccaagctggtgcatggtggcgtgcgctatctggct
cagggcaacatatctctcgtcaaagaagccttgcatgagcgaagcaccgttctgaacagt
gcgccccacctggcccagccgctcggctttctgatgccttgttacaaaacctggcaggtt
cccttttactggaccggacttcgactgtacgacacgctatccggacgacacagcctgggc
aagacggaaatactgaacgctggcaagacccgcagcctcctgcccaatgtcctttcctcc
ggtctggtcggcagtgtcaagtattgggatggtcagtttgatgacgcacgccttgcactg
gcaattgcgcgcaccgcccagcaggaaggtgcaacactattgaattactgcgaagttgtc
tccattgagcactttcaggacaaagtcagcggagtcgtcgtcaagaacacagaatcggga
cagacctggcaggtcaagtcttcctgcatcgtcaatgccaccggagtgtgggtcgactcg
cttcgaaaaatggatgatcacgcggcgggtcgtgagcccagaaagatggtcgcacccagt
cagggcgtacacattgtcgtcgaccggtcgttcatgtcatcagatcacgcacttatcgtc
cccaaaacagctgatggacgagtcctgtttgctgtgccatggctcgggaaggtgattctc
ggtacaactgacacggcacgtgaccagccactgaccgaaccacaggcattgaagtcagaa
cttgatttcatcctgaaagagtctgctgcgcacctgcagaaagcacccgcagtgcaggat
atccgcagcatctgggtcggactacggccgctggtaagacctcagaacaccaacgagggc
aacaccaagtcgatcagccgtgaacatacgatcatctcgagcgcaaccggcctggttacc
gtcacaggtggaaagtggactacctatcgggtgatggcgaaggacacagtcaatcactgc
atcaaagctggtgtgctggctgatcgcgcgacggtctgcacaaccgacacgctacgtctg
gtcggagcccagtcaggtcgcaggatgacacaaccaatcagccaggcacccgggctatcg
atctacggcgatgaacgggatcaggtcgaagcaaccgagggagcacacaatcagctcgca
gaggggctgaccgaagcaatggtacgctttgctgcccgctacgagtatgccagaaccgtc
gaagatgtccttgcgcgtcgttgccggatgctttttctggatgcagccctggcaacacaa
tgtgcaccgcaagtggcacagatcctgcaatccgaaaccggcatcgatccgcagcttgac
gcatttctatcgcttgccgaacactatcgcacgatcccgtacctgtag

DBGET integrated database retrieval system