KEGG   Bordetella sp. HZ20: DBV39_11780Help
Entry
DBV39_11780       CDS       T05532                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
boz  Bordetella sp. HZ20
Pathway
boz00473  D-Alanine metabolism
boz00550  Peptidoglycan biosynthesis
boz01100  Metabolic pathways
boz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:boz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DBV39_11780
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DBV39_11780
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DBV39_11780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:boz01011]
    DBV39_11780
Enzymes [BR:boz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DBV39_11780
Peptidoglycan biosynthesis and degradation proteins [BR:boz01011]
 Precursor biosynthesis
  Amino acid ligase
   DBV39_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 TTL ATPgrasp_ST ATP-grasp RimK ATPgrasp_YheCD GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AWB35792
UniProt: A0A2R4XPR0
LinkDB All DBs
Position
complement(2606261..2607229)
Genome map
AA seq 322 aa AA seqDB search
MVKQLGKVAVLYGGRSAEREVSLMSGQGVHAALLSRGVDAHLFDTASKPLSDLVSEGFDR
VFITLHGRFGEDGTMQGALELLQIPYTGSGHQACAIAMDKITTKRLWQQDGLPTPHCRVL
ADEADLDGLVQELGLPMILKAPNEGSTLGLYQVQSAPDLAQAYANARQFDRLVLAEQFIR
GRELTVAILGEGQDAQALPVIEIVAPGGQYDYEHKYFSDDTQYLCPAPLSDVVARKVMDL
ARDAYLSIGCSGWGRVDIMLDGNEQPWLLEVNTSPGMTSHSLVPMAAKAVGVSYAELCER
ILAQASCKVSPTPSSVSTGVKE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaacagttgggtaaggttgcggttctgtacgggggacgttcggctgaacgggag
gtgtcattgatgtctggccaaggggtccatgcggccttgctgagtcggggcgtggatgca
cacctgttcgacacggccagcaagcctttgagtgatttggtgagcgaggggtttgatcgg
gtttttattaccctgcatggacgcttcggtgaggacggcacgatgcagggcgcgcttgag
ctcctgcagataccttacacaggtagcgggcatcaggcgtgtgcaatcgccatggacaag
atcaccaccaagcgactctggcagcaagatggcttgcccaccccgcattgccgggttctg
gctgatgaagctgatctggatgggctcgttcaggagctcggtctgccaatgattctgaag
gcgcccaatgaaggctcgacgctgggcctgtatcaggtgcagtcggcgcccgatctggcg
caggcttatgcgaatgcgagacagtttgacaggctggtgctggccgagcagtttatccgt
ggaagagagctgacagttgcaattctgggcgaaggtcaggacgcccaggccttgccagtc
atcgagattgtcgctccaggtggccagtatgactacgagcacaagtatttctcggatgac
acgcaatacctttgccccgcaccactgagtgatgtggtggctcgcaaagtcatggatctg
gccagagatgcgtacctctccattggttgcagcggatgggggcgcgtggacatcatgctc
gacggcaacgaacagccctggcttctggaggttaacacctcgccagggatgaccagccat
tcgctggtgcctatggccgcgaaagccgtaggtgtttcttacgcggagttgtgcgagcgc
atccttgcccaggcaagttgcaaggtcagtcccacgccgtcgtcagtatcgacgggtgtc
aaggagtaa

DBGET integrated database retrieval system