KEGG   Bordetella sp. HZ20: DBV39_17080Help
Entry
DBV39_17080       CDS       T05532                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
boz  Bordetella sp. HZ20
Pathway
boz00061  Fatty acid biosynthesis
boz00620  Pyruvate metabolism
boz00640  Propanoate metabolism
boz01100  Metabolic pathways
boz01110  Biosynthesis of secondary metabolites
boz01120  Microbial metabolism in diverse environments
boz01130  Biosynthesis of antibiotics
boz01200  Carbon metabolism
boz01212  Fatty acid metabolism
Module
boz_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:boz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DBV39_17080 (accC)
   00640 Propanoate metabolism
    DBV39_17080 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DBV39_17080 (accC)
Enzymes [BR:boz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     DBV39_17080 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DBV39_17080 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A Oxidored_nitro LAL_C2
Motif
Other DBs
NCBI-ProteinID: AWB35163
UniProt: A0A2R4XMY5
LinkDB All DBs
Position
3734721..3736067
Genome map
AA seq 448 aa AA seqDB search
MFEKLLIANRGEIALRIQRACRELGIKTVVVHSEADRDAKYVRLADESVCIGPAPSKESY
LNMPAIISAAEVTDAEAIHPGYGFLSENADFAERVEKSGFVFVGPKPESIRLMGDKVSAK
RSMIEAGVPVVPGSEGALPEDPQEVLAIARKVGYPVIIKAAGGGGGRGMRVVHTEAALLS
AVTMTRTEAGAAFNNPEVYLEKFLENPRHVEIQVLADGGRRAVWLGERDCSMQRRHQKVI
EEAPAPGIPRRLIERIGERCAEACRKIGYRGAGTFEFLFENDEFYFIEMNTRIQVEHPVT
ELITGIDLVQQQIRIAAGEPFELRQRDIQFRGHALECRINAEDPFKFVPSPGRITNWHTP
GGPGVRIDSHAFNGYFVPPYYDSMIAKVITYGDTREQALARMRTALSEMVVEGINTNIAL
HRELLVDARFIEGGTSIHYLEHKLDERP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaacttctcattgccaaccgcggcgagatcgccctgcgcattcagcgtgcc
tgcagggaactggggatcaagacggttgttgttcactcagaggctgatcgcgacgcaaag
tacgtgcgactggccgacgaatcagtctgcattgggccagctccctccaaggaaagctat
ctgaatatgccggcgatcatttcggccgcggaagtcaccgatgccgaagcgattcaccct
ggttatggctttttgtccgagaatgcggactttgccgagcgagttgaaaaaagcggattt
gtttttgttggtcccaagccagagtcgatccggctgatgggagacaaggtcagtgccaag
cggtcgatgatcgaggctggtgtgccggttgtgccgggatcggaaggcgctttgccggaa
gaccctcaggaagtccttgcgattgctcgcaaagtgggctatccggtcatcatcaaagcg
gcaggcggtggcggtgggcgtggcatgcgtgttgtgcacaccgaggcggcgcttctaagc
gcggtcaccatgacccgaaccgaagctggcgcagcattcaacaatccggaagtctatctg
gagaaattcctggagaatcctcgccacgtcgagattcaggtcctggcagatggcggccgt
cgtgccgtatggcttggtgagcgtgactgctcgatgcagagacgtcaccagaaagtgatc
gaagaggcgccagcacccggtatcccccgacgactgatcgagcgaattggtgagcggtgt
gccgaagcgtgccgcaagattggctaccgcggggctggcacattcgagttcctgttcgag
aatgacgagttctatttcatcgagatgaacacccggattcaggtcgagcacccggtaacc
gagctgattaccggaattgatctggttcaacagcagatccggattgccgcgggggagcct
ttcgagttgcgccagcgcgatatccagttccgcggtcatgctctggagtgtcgtatcaac
gcggaagatccgttcaaattcgttcccagtccgggtcgaatcacgaactggcacactcct
ggggggccaggtgtgcgaatcgactcgcacgcatttaatggctactttgtgcctccttac
tacgactcaatgattgccaaggttatcacctacggtgatacccgtgagcaggcactggct
cgtatgcgtacggcgctttccgagatggtggttgaagggatcaataccaatatcgccttg
catcgcgagttgctggttgacgctcgcttcatcgagggaggaacaagcattcactacctc
gagcacaaactggatgagcgtccctga

DBGET integrated database retrieval system