KEGG   Bordetella sp. HZ20: DBV39_18060Help
Entry
DBV39_18060       CDS       T05532                                 

Gene name
dppD
Definition
(GenBank) dipeptide ABC transporter ATP-binding protein DppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
boz  Bordetella sp. HZ20
Pathway
boz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:boz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DBV39_18060 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:boz02000]
    DBV39_18060 (dppD)
Transporters [BR:boz02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    DBV39_18060 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_22 TniB AAA_16 SMC_N AAA_29 ABC_ATPase AAA_7
Motif
Other DBs
NCBI-ProteinID: AWB35328
UniProt: A0A2R4XNI4
LinkDB All DBs
Position
complement(3963607..3964611)
Genome map
AA seq 334 aa AA seqDB search
MTTDLAFIKIENLNITFNAGKKPVKAVDGVNLSVKRGEVIALIGESGSGKSVTLRSVLKL
HPPRRTQMQGRILVDGQDVMTLSGKALADFRGSKVSMIFQEPLLALDPVYTVGEQITEAI
RRHDNVTREEALQRALDLFERVRIPSPQRRLNAYPHEMSGGMRQRAMISLALASRPKLLL
ADEPTTALDATVQIQILLLLRELQRELGLSVIFVTHDIGAAVEVADRIAVMYAGRIVEEG
PVREIIRHPAHPYTQALLRSASHGGFAKGERLETIAGSPPDLANLPEGCSFAPRCPRATE
QCRQIDPQETWIDDTHRARCIRIESVSEATTAAV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggatctcgccttcatcaagatcgaaaacctgaacatcactttcaatgcgggc
aagaagccagtcaaagccgttgacggcgtcaacctcagcgtcaagcgtggcgaagtcatc
gcactgatcggtgagtcaggttctggtaaaagtgtcacattgcgatcggtcctcaagctg
cacccgccgcggcgcacgcagatgcaaggacgcatcctggtggacgggcaggatgtcatg
acgctctcgggcaaggcgctggctgactttcgtggcagcaaggtgtcaatgatcttccag
gagcctttgctggcactggatcccgtttacacagtcggcgagcagatcaccgaagccatt
cgccgccatgacaacgtaacccgtgaagaagcccttcagcgggcactggatctgttcgaa
cgggtccggatcccgagtccgcaacgccgactcaatgcttatccgcacgagatgtccggg
ggcatgcgccaacgcgccatgatctcgctagcgcttgcgagccgacccaagcttctgctt
gcggacgagcccacaactgcacttgacgcgactgtccagatccagatcttgctgctgtta
cgggaactccagcgtgagctcggcctgtcggtcatctttgtgacccatgacatcggcgcg
gcggtcgaagtagctgaccgaatcgccgtaatgtatgcgggacgaatcgtagaggaaggc
ccggttcgggagatcatccggcatccggcgcacccctatacccaggcattgctcaggagc
gcatcgcatggcgggttcgccaaaggcgaacgacttgaaacgatcgccggatcccctccc
gatctggctaacctgccagagggctgttcgtttgctcctcgctgtcccagggcaactgaa
caatgtcgtcagattgatccgcaggaaacctggatcgatgacactcaccgggcacgctgc
atccgcatcgaatcggtatcagaggcaaccacagcagccgtctga

DBGET integrated database retrieval system