KEGG   Bordetella parapertussis 12822: BPP0166Help
Entry
BPP0166           CDS       T00140                                 

Definition
(GenBank) putative penicillin-binding protein precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00550  Peptidoglycan biosynthesis
bpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BPP0166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bpa01002]
    BPP0166
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
    BPP0166
Enzymes [BR:bpa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BPP0166
Peptidases and inhibitors [BR:bpa01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BPP0166
Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BPP0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 DUF1381
Motif
Other DBs
NCBI-ProteinID: CAE39907
GeneDB: BPP0166
UniProt: Q7W226
LinkDB All DBs
Position
180493..181749
Genome map
AA seq 418 aa AA seqDB search
MKTLPDTAIAPVVLSRRVLASAVLAAMLAAAAPAGAQQQAAPATPVAAAAPAAGGAVGAV
GDLAAVPVPTIAAKAWITVDVNSGQVLAASNADMKVEPASLTKIMTAYVVFNALQEKRLT
LEQQVPVSEHAWRTGGSRMFIEPRKPVTVDELNQGMIVQSGNDASVALAEAVGGSESAFA
ALMNQEAQRLGMRNTHFMNSTGLPDPQHVTTARDLATLAVHLLSDYPDYYHYYKQKSYTY
NKITQPNRNRLLWADPSVDGMKTGHTDSAGYCLVSTAMRGDRRILTVLVGADSEATRAEE
SLKLLNWSFQNFDTVKLYDQSQPGLDARVWEGKVENVKLGPPNPVWLAVPRGKAAEIKPV
AQRTDPLVAPLTKGQQVGTLQLTLDGKTLRVEPLVVQEDVERAGFFGRMADTVKRWFQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttgcctgatactgctattgcccccgtcgttctttcccgtcgcgtattggcc
agcgccgtgctggctgccatgctggccgctgcggcgccggccggggcccagcagcaggcg
gcgcccgccacgcctgtcgccgccgccgcgcccgcggcgggcggcgcggtaggcgccgtg
ggagacctggcggccgtgccggtgccgaccatcgccgccaaggcgtggatcaccgtggat
gtcaacagcggccaggtgctggcagcctccaacgccgacatgaaggtcgagccggcctcg
ctgaccaagatcatgactgcctatgtggtgttcaacgcgctgcaggaaaagcgcctgacc
ctggagcagcaggtcccggtctccgagcacgcatggcgcaccggcggttcgcgcatgttc
atcgagccgcgcaagccggtgacggtcgacgaactgaaccagggcatgatcgtccagtcg
ggcaatgacgcatcggtcgcgctggccgaagccgtcggcggcagcgaaagcgcctttgcg
gccctgatgaaccaggaggcgcagcgcctgggcatgcgcaatacgcacttcatgaactcc
accggcctgcccgatccgcagcacgtcaccacggcgcgcgacctggccacgctggcggtg
cacctgctctcggattacccggactactaccactactacaagcagaaaagctacacgtac
aacaagatcacccagcccaaccgcaaccgcctgttgtgggccgatccgtcggtcgacggc
atgaagacggggcacaccgattcggccggctactgcctggtttcgaccgccatgcgcggc
gaccgccgtatcctgaccgtgctggtgggcgccgacagcgaagccacgcgcgccgaggaa
agcctcaagctgctcaactggagcttccagaacttcgatacggtcaagctgtacgaccag
agccagcccgggctggacgcgcgggtctgggaaggcaaggtcgagaacgtcaagctgggt
ccgcccaacccggtgtggctggcggtgccgcgcggcaaggcggccgagatcaagccggtc
gcgcagcgcaccgacccgctggtggcgccgctgaccaagggacagcaggtcggcacgctg
cagctcacgctcgatggcaagaccttgcgcgtcgaaccgctggtggtccaggaagacgtc
gagcgcgccggcttcttcggccgcatggccgacaccgtgaagcgctggttccagtaa

DBGET integrated database retrieval system