KEGG   Bordetella parapertussis 12822: BPP0901Help
Entry
BPP0901           CDS       T00140                                 

Definition
(GenBank) probable FAD dependent oxidoreductase
Organism
bpa  Bordetella parapertussis 12822
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CAE40309
GeneDB: BPP0901
UniProt: Q7W104
LinkDB All DBs
Position
complement(973160..974314)
Genome map
AA seq 384 aa AA seqDB search
MAISAAADAAPRFSGHDVIVVGGGLVGSALAYGLRRRLDRVAVLDEGDLAYRASRGNFGL
IWVQSKGMGMPRYGVWTMASQRAWPDLAARLLEESGIDVHLEQQGGLHVLLSDEEVQARI
DFMTRLLAQPGMSDYAWKLLDRHELADLVPGIGPEVRGASWTPVDGIANPLKLLRALHTT
FERNGVDYLPRCPAQSISRHADGMFVVDTPRGRLQAPRLVLACGLGNQAMGAQVGLDIPV
RPQRGQIIVLERTHRVLRTPISTLRQMDEGSWLIGDSQEEAGYADNEVSLPILGTLADRA
VRTLPALREVNVVRSWSALRVMSPDGFPIYAQSATCPGAFVATCHSGVTLAGAHALLLAP
MIADGALAGDMAPFSARRFHVQEA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcagtgcagcggcggacgcggcgccgcggttctccggccacgatgtcatcgtc
gtgggaggcggactggtaggctccgcgctggcctatgggctgcgccgccgcctggatcgc
gtggccgtgctggacgaaggcgacctcgcctaccgcgcctcgcgcggcaacttcggcctg
atatgggtgcagagcaagggcatgggcatgccgcgctacggcgtgtggaccatggcctcg
cagcgggcatggccggacctggcggcgcggctgctcgaggaatccggcatcgacgtgcac
ctggagcagcaaggcggcctgcacgtgctgctgtcggacgaggaggtgcaggcgcgcatc
gacttcatgacgcggctgctggcgcaacccggcatgagcgactacgcatggaagctgctc
gatcgccatgagctggccgacctggtgcccggcatcggccccgaggtgcgcggcgccagc
tggacgccggtcgacggcatcgccaaccccctcaagctgctgcgcgccttgcacaccacc
ttcgagcgcaacggcgtggactacctgccgcgctgcccggcgcagtccatcagccggcat
gccgacggcatgttcgtcgtcgacaccccgcgcggccgcttgcaggcgccgcgcctggtg
ctggcatgcgggctgggcaaccaggccatgggcgcgcaggtcggcctggacatcccggtg
cggccgcagcgcggccagatcatcgtgctggaacgcacccatcgggtgctgcgcacgccg
atcagcacgctgcggcagatggacgagggcagctggctgatcggcgactcgcaggaagaa
gcgggttacgccgacaacgaagtcagcctgcccatactcggcacgctggccgaccgcgcc
gtgcgcaccctgccggcgctgcgcgaggtcaacgtggtgcgctcctggtcggcgctgcgc
gtgatgtctccggacggctttcccatctacgcgcagtccgcgacctgccccggcgccttc
gtggccacctgccacagcggcgtcaccctggccggcgcccatgcgctgctgctcgccccc
atgatcgccgacggcgcgctggccggcgatatggctcccttctctgcacggaggtttcat
gttcaagaggcttga

DBGET integrated database retrieval system