KEGG   Bordetella parapertussis 12822: BPP1538Help
Entry
BPP1538           CDS       T00140                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristol-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00061  Fatty acid biosynthesis
bpa00780  Biotin metabolism
bpa01100  Metabolic pathways
bpa01212  Fatty acid metabolism
Module
bpa_M00083  Fatty acid biosynthesis, elongation
bpa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BPP1538 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BPP1538 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpa01004]
    BPP1538 (fabZ)
Enzymes [BR:bpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BPP1538 (fabZ)
Lipid biosynthesis proteins [BR:bpa01004]
 Fatty acid synthase
  Component type
   BPP1538 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: CAE36840
GeneDB: BPP1538
UniProt: Q7WA49
LinkDB All DBs
Position
1646434..1646937
Genome map
AA seq 167 aa AA seqDB search
MAAHCNIIYFCFAGKQMELDIKGIMDRLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEP
FFTGHFPHHPVMPGVLIVEAMAQASALFSFTDENGGLKCDGAKTAYYLVGIDGARFRKPV
VPGDQLRLEVEAERLSCTICKYQGRALVDGQLVAEAKLMCAIRSLEE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcgcattgcaacataatctatttttgctttgcaggaaaacaaatggaactcgac
atcaaggggatcatggaccggctgccgcatcgctacccgatgctgctgatcgaccgtgtg
ctggagatggtgcccggcaaatccatcgttgccatcaagaacgtctcgatcaacgagccg
tttttcacgggccattttccgcatcatccggtcatgccgggcgtgctgatcgtcgaggcc
atggcgcaggcttcggccctgttctcgttcaccgacgagaacggcgggctgaagtgcgac
ggcgccaagaccgcctactacctggtgggcatcgacggcgcgcggttccgtaaacccgtg
gtgccgggcgaccagttgcggctggaagtcgaggccgagcgcctgtcgtgtaccatctgc
aagtaccagggccgggccctggtcgacggccaactggtcgccgaagccaagctgatgtgc
gcgatccgtagcctggaagagtaa

DBGET integrated database retrieval system