KEGG   Bordetella parapertussis 12822: BPP2431Help
Entry
BPP2431           CDS       T00140                                 

Definition
(GenBank) aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00250  Alanine, aspartate and glutamate metabolism
bpa00280  Valine, leucine and isoleucine degradation
bpa00410  beta-Alanine metabolism
bpa00640  Propanoate metabolism
bpa00650  Butanoate metabolism
bpa01100  Metabolic pathways
bpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPP2431
   00650 Butanoate metabolism
    BPP2431
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPP2431
   00280 Valine, leucine and isoleucine degradation
    BPP2431
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPP2431
Enzymes [BR:bpa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BPP2431
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BPP2431
Amino acid related enzymes [BR:bpa01007]
 Aminotransferase (transaminase)
  Class III
   BPP2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CAE37727
GeneDB: BPP2431
UniProt: Q7W7S9
LinkDB All DBs
Position
complement(2604677..2605951)
Genome map
AA seq 424 aa AA seqDB search
MDNAELTRRKEAATPRGVGVMCNFYADRAENAELWDTEGRRYIDFAGGIAVLNTGHRHPQ
LMQALQAQMSRFTHTAYQIVPYASYIQLAERINQLAPGDFAKKTALFTTGAEAVENAVKI
ARAATGRPAVVAFGAAFHGRTLLGMALTGKVVPYKVGFGPFPADIYHVPYPNALHGVSTD
DALAALGTLFKTDVDPRRVAAIIIEPVQGEGGFNICPPAFMQALRALCDDHGILLIADEV
QTGFGRTGKLFAMEHYGVAADLTAMAKSLAGGMPLSAVCGRAEVMDAPPPGGLGGTYAGN
PLAVAAALEVIRIIEAEDLLARGTRLGHQLRDHLEAQRHDVPEIAEVRALGAMVAVEFRQ
PGSDAPSPEFARQVQARALEQGLLLLTCGSDGNVIRFLFPLTIPEAVMREALDILARTLR
GQNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcagaactgacccgccgcaaggaggccgccacgccgcgcggcgtgggcgtg
atgtgcaacttctacgcggaccgcgccgagaacgccgaactgtgggataccgaaggccgc
cgctacatcgacttcgccggcggcatcgccgtgctcaacaccggccatcgccatccgcag
ctgatgcaggcgctgcaggcgcagatgagccgcttcacccacacggcctaccagatcgtc
ccgtacgccagctatatccagctggccgaacggatcaaccagctggcgccgggcgatttc
gccaagaagaccgccctcttcaccacgggagccgaggcggtcgagaacgccgtcaagatc
gctcgcgcggccaccggccggcccgccgtcgtcgccttcggcgcggcgttccacggccgc
acgctgctgggcatggccctgaccggcaaggtcgtgccgtacaaagtgggcttcggtccg
tttccggccgacatctaccatgtgccgtatccgaacgcgctgcacggggtatccaccgat
gacgcgctggcggccctggggaccctattcaagaccgacgtggacccgcgccgcgtggcg
gccatcatcatcgaaccggtacagggcgagggcggtttcaatatctgcccgccggccttc
atgcaggcgctgcgcgccctgtgcgacgaccacggcatcctgctgatcgccgacgaagtc
cagaccggcttcggccgcaccggcaagctgttcgcgatggaacactacggcgtggcggcc
gacctgaccgccatggccaagagcctggccggcggcatgccgctgtcggcggtgtgcggc
cgcgccgaggtcatggacgcgccgccgccgggcggcctgggcggcacctatgccggcaat
ccgctggcggtcgccgccgcgctggaggtgatccgcatcatcgaggccgaggacctgctg
gcgcgcggcacgcgcctgggccaccagttgcgcgaccacctggaggcgcagcgccacgac
gtccccgagatcgccgaggtgcgggcgctgggcgccatggtggcggtggaattccgccag
cccggcagcgatgcgcccagccccgaattcgcgcgccaggtccaggcccgcgcgctcgaa
caggggttgctgctcctgacctgcggcagcgacggcaacgtcatccgctttcttttcccg
ctgacgatcccggaggcggtcatgcgcgaagcgctggacatcctggcccggacgttgcgc
ggccagaacgcttga

DBGET integrated database retrieval system