KEGG   Bordetella parapertussis 12822: BPP2742Help
Entry
BPP2742           CDS       T00140                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BPP2742 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpa02000]
    BPP2742 (gst)
Enzymes [BR:bpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BPP2742 (gst)
Transporters [BR:bpa02000]
 Other Transporters
  Pores ion channels [TC:1]
   BPP2742 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-ProteinID: CAE38035
GeneDB: BPP2742
UniProt: Q7W6Z7
LinkDB All DBs
Position
2938516..2939139
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDYLRVNPKGRVPALATE
HGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALGERFSVVDGYLYTVGSWMEGDSVDMT
RFPKLADYLARVGARPAVQRALAEMNG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctggactttctataccgcccctggcacctgtgcgctggcgacgcacatcgcg
ctgcacgaagccggcgccgatttcgatctggtcaagctggatttcggcgccacgcagcag
caaagccccgactacctgcgcgtcaaccccaagggccgcgtgccggcgctggccaccgaa
catggcgtgctgaccgagaatcccgccctgctcgctttcatcgcgcagagctttccgcag
gcgcagctggcgccgctgggcgatccgttcgcgttcgcgcgcatgcaggaactggccaac
tacctggcctccaccgcgcacgtcgcgcacgcgcacaaacggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaggccatgcgcgccaagatccccgagaacatgacggccatc
gccggctacctggaatcgcagatcgtcggtccctgggcactgggcgagcgcttcagcgtg
gtcgacggctatctgtacaccgtcggcagctggatggaaggcgacagcgtcgacatgacg
cgctttcccaagctggccgactacctggcgcgcgtcggcgcgcggccggccgtgcagcgc
gcgctggccgagatgaacggctga

DBGET integrated database retrieval system