KEGG   Bordetella parapertussis 12822: BPP3750Help
Entry
BPP3750           CDS       T00140                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00473  D-Alanine metabolism
bpa00550  Peptidoglycan biosynthesis
bpa01100  Metabolic pathways
bpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BPP3750 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BPP3750 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BPP3750 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
    BPP3750 (ddlB)
Enzymes [BR:bpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BPP3750 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
 Precursor biosynthesis
  Amino acid ligase
   BPP3750 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL ATPgrasp_ST ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CAE39033
GeneDB: BPP3750
UniProt: Q7W4B6
LinkDB All DBs
Position
complement(4053927..4054877)
Genome map
AA seq 316 aa AA seqDB search
MSKQFGKVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFER
VFIALHGRYGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVL
GGSTELRLVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKAAYELAARFDAEVLAEQFIT
GRELTVAVLGSGAAARALPVIEIVAPGGNYDYEHKYFSDDTQYFCPADLPADVAADVAAV
AERAYAALGCEGWGRVDFILDRENRPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVA
ILAKAACKVRSPARQD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaattcggcaaagtcggcgtgttgtacggcggccgttcggccgagcgggaa
gtgtcgctgatgtccggcaagggcgtgcacgaagccctgctgagcgccggcgtggacgcg
cacctgttcgacaccggcgagcgcagcctggcggacctcgccgcggcgggtttcgagcgc
gtgttcatcgccctgcatggccgctatggcgaggacggcacgctgcagggagcgctggag
ctgctgggcattccttacaccggcagcgggccgctggcctccagcctgtcgatggacaag
atcatgaccaagcgggtgtggctgcagcacggcttgcccacgccggccttcgaggtgctg
ggcggcagcaccgaactgcgcctggtgcccgaccgcctgggcctgccgctgatactcaag
ccgccgcacgagggctcgaccgtcggcatcaccaaggtggcgggctattcggacatgaag
gcggcgtacgagctggccgcgcgtttcgacgccgaggtgctggccgaacagttcatcacg
ggccgcgaactgaccgtcgccgtgctgggctcgggcgccgcggcgcgcgccttgccggtg
atcgagatcgtcgcgcccggcggcaattatgactacgaacacaagtacttctcggacgac
acgcagtacttctgcccggccgacctgcccgcggacgtggccgcggacgtggccgccgtc
gccgagcgcgcctacgccgcgctgggttgcgagggttggggccgggtcgacttcatcctg
gaccgggagaaccggccctggctgctggaaatgaatacttcgcccggcatgaccggccat
tcactggtgccgatggcggcgcgcgcggtgggcatgagctatgccgacctgtgcgtggcc
atcctggccaaggctgcgtgcaaagtgcgcagcccggcgcgacaagattga

DBGET integrated database retrieval system