KEGG   Bordetella parapertussis 12822: BPP3750Help
Entry
BPP3750           CDS       T00140                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00473  D-Alanine metabolism
bpa00550  Peptidoglycan biosynthesis
bpa01100  Metabolic pathways
bpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BPP3750 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BPP3750 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BPP3750 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
    BPP3750 (ddlB)
Enzymes [BR:bpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BPP3750 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bpa01011]
 Precursor biosynthesis
  Amino acid ligase
   BPP3750 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL ATPgrasp_ST ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CAE39033
GeneDB: BPP3750
UniProt: Q7W4B6
LinkDB All DBs
Position
complement(4053927..4054877)
Genome map
AA seq 316 aa AA seqDB search
MSKQFGKVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFER
VFIALHGRYGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVL
GGSTELRLVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKAAYELAARFDAEVLAEQFIT
GRELTVAVLGSGAAARALPVIEIVAPGGNYDYEHKYFSDDTQYFCPADLPADVAADVAAV
AERAYAALGCEGWGRVDFILDRENRPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVA
ILAKAACKVRSPARQD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaattcggcaaagtcggcgtgttgtacggcggccgttcggccgagcgggaa
gtgtcgctgatgtccggcaagggcgtgcacgaagccctgctgagcgccggcgtggacgcg
cacctgttcgacaccggcgagcgcagcctggcggacctcgccgcggcgggtttcgagcgc
gtgttcatcgccctgcatggccgctatggcgaggacggcacgctgcagggagcgctggag
ctgctgggcattccttacaccggcagcgggccgctggcctccagcctgtcgatggacaag
atcatgaccaagcgggtgtggctgcagcacggcttgcccacgccggccttcgaggtgctg
ggcggcagcaccgaactgcgcctggtgcccgaccgcctgggcctgccgctgatactcaag
ccgccgcacgagggctcgaccgtcggcatcaccaaggtggcgggctattcggacatgaag
gcggcgtacgagctggccgcgcgtttcgacgccgaggtgctggccgaacagttcatcacg
ggccgcgaactgaccgtcgccgtgctgggctcgggcgccgcggcgcgcgccttgccggtg
atcgagatcgtcgcgcccggcggcaattatgactacgaacacaagtacttctcggacgac
acgcagtacttctgcccggccgacctgcccgcggacgtggccgcggacgtggccgccgtc
gccgagcgcgcctacgccgcgctgggttgcgagggttggggccgggtcgacttcatcctg
gaccgggagaaccggccctggctgctggaaatgaatacttcgcccggcatgaccggccat
tcactggtgccgatggcggcgcgcgcggtgggcatgagctatgccgacctgtgcgtggcc
atcctggccaaggctgcgtgcaaagtgcgcagcccggcgcgacaagattga

DBGET integrated database retrieval system