KEGG   Bordetella parapertussis 12822: BPP3838Help
Entry
BPP3838           CDS       T00140                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00061  Fatty acid biosynthesis
bpa00780  Biotin metabolism
bpa01100  Metabolic pathways
bpa01130  Biosynthesis of antibiotics
bpa01212  Fatty acid metabolism
Module
bpa_M00083  Fatty acid biosynthesis, elongation
bpa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bpa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BPP3838 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BPP3838 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BPP3838 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpa01004]
    BPP3838 (fabI)
Enzymes [BR:bpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BPP3838 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BPP3838 (fabI)
Lipid biosynthesis proteins [BR:bpa01004]
 Fatty acid synthase
  Component type
   BPP3838 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CAE39121
GeneDB: BPP3838
UniProt: Q7W433
LinkDB All DBs
Position
4156438..4157223
Genome map
AA seq 261 aa AA seqDB search
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIV
LPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDIS
AYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGP
RGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVSNVAAFMLSDLAAG
ITGEITHVDAGFSTVVPGMEN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgccggcaagcgcatcctcatgaccggggtgctttccaaccgatccatc
gcctacggcatcgcgcgcgcctgccgcgaccagggcgccgacctggcgttcacctacgtg
ggcgaccgcttcaaggaacgcatcaccgaattcgccgcctcgttcggcagcgacatcgtg
ctgccctgcgacgtggccgaggacagccagatcgacgccgccttcgccgaactgggcaag
cgctgggacggcctggacggcctggtgcacgccatcggcttcgcgccgcgcgaagcgatc
gccggcgacttcctcgacggcctgtcgcgcgagaacttccgtatcgcgcacgatatctcg
gcctacagcttcccggccatggccaaggcggcgctgccgctgatggaaggccgcaagggc
tcggtcctgaccctgagctacctgggctccgagcgcgtggtcgccaactacaacaccatg
ggcctggccaaggcctcgctggaagccagcgtgcgctacctggccaccgccctcggcccg
cgcggcatccgcgccaacgccatctcggccggccccatcaagacgctggccgccagcggc
atcaaggacttctcgtcgatcctgaagttcgtcgaagccaacgccccgctgcgccgcaac
gtcaccatcgaagacgtcagcaacgtcgccgccttcatgctgtccgacctcgccgccggc
atcaccggcgaaatcacccacgtcgacgccggcttctcgaccgtcgtcccgggaatggaa
aactga

DBGET integrated database retrieval system