KEGG   Borrelia parkeri: X966_01215Help
Entry
X966_01215        CDS       T03987                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpak  Borrelia parkeri
Pathway
bpak00564  Glycerophospholipid metabolism
bpak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    X966_01215
Enzymes [BR:bpak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     X966_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AHE62577
LinkDB All DBs
Position
249597..251159
Genome map
AA seq 520 aa AA seqDB search
MGKNKKKELRDIDNQDFDLIIVGGGATGLGIGIDSITRGYKTLLIEKFDYAKGTSSRSTK
LIHGGVRYLAQLNVPLVKEALYEKALLETNAPHLVSKCAFVTPIYNILNIPYYYFGLSWY
HNLLGKHKKSQYKTKLLSKSKTIEKMPNIKTKGLKCSVLYYDASFDDARMAISMLRTFTE
KGGIAFNYTEPTNFIKKNGKISGAIIKDKMTGKQVIINSKCIINATGIFADEIRKLDDAN
AANIIKPSQGTHLVIKKEKLHTEYAMLMPKTSDKRILFAIPWYDVTVCGTTDIAINKIEE
EPKRLESEIEFIIKNMNNYLNIKITKNDILSVYSGIRPLIVDPKEKKNTSKISRNDKIFV
SDSNLITIAGGKYTTYRKMAEKVLKKAIEENLIPDSTSITENFKLHGYIEREEVLKIPEY
FRAYGSDFEHLSQMKDFNKKIHTDLPLNEAQITFAIEFEQAKTVEDILSRRTRSLLFNAK
ATIESTPKVAEIMMHKLGKSKEWKTEQIKSFKEVAIKYLV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaataaaaaaaaagaattaagagatattgataatcaagattttgacttaata
atagttggcggaggagcaactggccttggcattggaatagattcaattacaagaggatac
aaaaccttactcattgaaaaatttgattatgcaaaaggtacttcctccagatcaactaaa
ctaatacacggaggcgtaaggtatttagcacaattaaatgtgcctttagtaaaagaggcc
ttatatgaaaaagctttacttgaaacaaatgcaccccacttagttagtaaatgtgcattt
gttacgccaatatataacattttaaatattccttactactatttcggattaagttggtat
cacaaccttcttggcaagcataaaaaatctcagtataaaacaaagctattatcaaaatct
aagacaatagaaaaaatgccaaatatcaaaaccaaaggccttaaatgctctgttttatac
tacgatgcttcatttgatgatgccagaatggcaataagcatgcttagaactttcactgaa
aaaggaggaattgcgtttaattatacagaacccacaaattttatcaaaaaaaatggcaaa
atatctggtgctattattaaagataaaatgactggaaaacaagttatcattaatagcaaa
tgcataataaacgcaacaggaatctttgcagacgagatcagaaaattagatgatgctaat
gcagctaacattataaaaccttcccaaggaacacatttagtaattaaaaaagagaaacta
cataccgaatacgcaatgcttatgcccaagacaagtgataagagaatcttatttgctata
ccttggtatgatgtcactgtttgcggaactacagatattgcaataaacaaaattgaggaa
gagcctaaaagactagagagtgaaattgaattcataataaaaaatatgaataattactta
aatattaaaataaccaaaaatgatattctaagtgtttactcaggaattagacccttaata
gtagatcccaaagagaaaaaaaatacctcaaaaatatcaagaaacgataaaatatttgta
tcagactcaaatctcattacaattgccgggggaaaatatactacttacagaaagatggct
gaaaaagttctaaaaaaagcaatagaagaaaatttaatacctgattcaacatctataaca
gaaaatttcaagctgcatgggtatatagaaagagaagaagtacttaaaattcctgaatat
tttagagcttatggaagtgatttcgaacatttaagtcaaatgaaagactttaacaaaaag
attcacacagacctgccattaaatgaagcccaaataacctttgccattgaatttgaacaa
gcaaaaactgttgaagacattttatcaagaagaacaagatcattactttttaatgcaaaa
gccacaattgaatccacaccaaaggtcgctgaaattatgatgcataaacttggcaaatct
aaagaatggaaaacagagcaaataaaaagctttaaagaggtagcgataaaatatttagtt
taa

DBGET integrated database retrieval system