KEGG   Bordetella parapertussis Bpp5: BN117_0071Help
Entry
BN117_0071        CDS       T02297                                 

Gene name
aroK
Definition
(RefSeq) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01130  Biosynthesis of antibiotics
bpar01230  Biosynthesis of amino acids
Module
bpar_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN117_0071 (aroK)
Enzymes [BR:bpar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BN117_0071 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 TsaE AAA_16 AAA AAA_25 APS_kinase AAA_5 Zeta_toxin Ploopntkinase3 Cytidylate_kin2 ATP_bind_2 AAA_7
Motif
Other DBs
NCBI-GeneID: 13888107
NCBI-ProteinID: YP_006894166
UniProt: K0M9Q3
LinkDB All DBs
Position
65994..66629
Genome map
AA seq 211 aa AA seqDB search
MNASANLCAASANDPQPGDQEAAHPVACAGDEPAAFLPHDLPIFLVGMMGAGKTTIGRGL
ARALRREFIDLDHELEARCGVRVPVIFEIEGEAGFRRREAAALQECTQRRQIILATGGGA
VLAAENRQALRERGIVIYLRASVEELFRRTSRDRNRPLLATADPRATLRELMVAREPLYN
EVADLVIDTGSMPIATLVKSLLPKLQAYEKK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttccgctaatttatgcgcggcgtccgccaacgacccgcaaccgggcgaccag
gaggccgcccaccctgtagcctgcgccggtgacgagccggcggcgttcctgccgcacgac
ctgccgatctttctggtggggatgatgggcgccggcaagaccaccatagggcgaggcctg
gcgcgtgcgctgaggcgcgaattcatcgatctcgaccatgagttggaggcgcgttgcggc
gtgcgggttccggtcatcttcgaaatcgaaggcgaagccgggtttcgccggcgggaagct
gccgcattgcaagagtgtacccaacgccggcagataattcttgccaccggcgggggcgcg
gtgctggccgcggagaaccggcaggccctgcgcgagcgcggcatcgtgatctacctgcgc
gccagcgtggaagagctgttccggcgcaccagccgcgatcgcaaccgccccttgctggcc
accgccgatccgcgcgctaccctgcgcgagctgatggtggcgcgcgaaccgctgtataac
gaggtggccgatctggtcatcgataccggcagcatgcccatcgccacgctggtgaagtcc
ctgctgcccaagctgcaagcctacgagaagaaataa

DBGET integrated database retrieval system