KEGG   Bordetella parapertussis Bpp5: BN117_1510Help
Entry
BN117_1510        CDS       T02297                                 

Gene name
goaG
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00250  Alanine, aspartate and glutamate metabolism
bpar00410  beta-Alanine metabolism
bpar00640  Propanoate metabolism
bpar00650  Butanoate metabolism
bpar01100  Metabolic pathways
bpar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN117_1510 (goaG)
   00650 Butanoate metabolism
    BN117_1510 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN117_1510 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN117_1510 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpar01007]
    BN117_1510 (goaG)
Enzymes [BR:bpar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN117_1510 (goaG)
Amino acid related enzymes [BR:bpar01007]
 Aminotransferase (transaminase)
  Class III
   BN117_1510 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 13889546
NCBI-ProteinID: YP_006895483
UniProt: K0MC26
LinkDB All DBs
Position
complement(1639650..1640915)
Genome map
AA seq 421 aa AA seqDB search
MKNRDLNTRRTLATPRSVGVMCDFYAVRAENSTLWDAEGKEYIDFAGGIAVLNTGHRHPK
VKAAIAAQLDNFTHTAYQIVPYEGYVSLAERINAVAPIEGLKKTAFFTTGVEAVENAVKI
ARAYTGRSGVVTFSGAFHGRTMMGMALTGKVAPYKLAFGPMPGDVFHVPFPNATQAISVA
DSLKALDLLFKVDIDPKRVAAIIIEPVQGEGGFNVTPPELMQALRKVCDEHGILLIADEV
QTGFARTGKLFAMQHHSVQADLITMAKSLGGGMPISGVVGRAEVMDGPAAGGLGGTYAGN
PLAVAAAHAVLDVIAEEKLCERAAELGKRLMDRLEGLRAKCPAIADVRGLGSMVALELND
PATGKPDAEAVKRIQQQAIERGLILLSCGVYGNVLRFLYPLTIPDDQFARALDILAETIA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccgagatctgaatacgcgtcgtacgctggccaccccacgcagcgtcggcgtg
atgtgtgacttttacgccgtgcgggcggaaaactcgaccctgtgggatgccgagggcaag
gagtacatcgacttcgccggcggcatcgcggtgctgaacaccggccatcgccatcccaag
gtcaaggccgccatcgccgcccagctggacaacttcacccacaccgcctaccagatcgtg
ccgtacgaaggctacgtatcgctggccgagcgcatcaacgccgtggccccgatcgaaggc
ctgaagaagaccgccttcttcaccaccggcgtcgaggcggtggaaaacgccgtcaagatc
gcccgcgcctacaccggccgctcgggcgtggtgacgttctcgggcgcgttccatggccgc
accatgatgggcatggccctgaccggcaaggtcgcgccctacaagctggcgttcggcccg
atgccgggcgacgtgttccacgtaccgttccccaacgccacgcaggccatcagcgtggcc
gactcgctcaaggccctggacctgctgttcaaggtcgacatcgatcccaagcgcgtggcc
gccatcatcatcgagccggtgcaaggcgaaggcggcttcaacgtcacgccgcccgaactg
atgcaggcgctgcgcaaggtgtgcgacgagcacggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcgcgcaccggcaagctgttcgccatgcagcaccattcggtacaggcc
gacctgatcaccatggccaagagcctgggcggcggcatgccgatctcgggcgtggtgggc
cgcgccgaagtcatggacggcccggccgccggcggcctgggcggcacctacgccggcaac
ccgctggccgtggccgccgcgcacgcggtgctggacgtgatcgccgaggaaaaactgtgc
gagcgcgccgccgaactgggcaagcgcctgatggaccgcctggaaggcctgcgcgccaag
tgcccggccatcgccgacgtgcgcggcctgggttcgatggtcgcgctggagctgaacgac
ccggccaccggcaagcccgacgccgaggcggtcaagcgcatccagcagcaagccatcgag
cgcggcctgattttgctaagctgcggtgtgtacggaaacgttctgcgtttcctgtatccc
ctgaccatccccgatgaccagttcgctcgcgcgctggacatcctggccgaaaccatcgcc
gcctga

DBGET integrated database retrieval system