KEGG   Bordetella parapertussis Bpp5: BN117_1757Help
Entry
BN117_1757        CDS       T02297                                 

Definition
(RefSeq) aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00250  Alanine, aspartate and glutamate metabolism
bpar00280  Valine, leucine and isoleucine degradation
bpar00410  beta-Alanine metabolism
bpar00640  Propanoate metabolism
bpar00650  Butanoate metabolism
bpar01100  Metabolic pathways
bpar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN117_1757
   00650 Butanoate metabolism
    BN117_1757
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN117_1757
   00280 Valine, leucine and isoleucine degradation
    BN117_1757
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN117_1757
Enzymes [BR:bpar01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN117_1757
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BN117_1757
Amino acid related enzymes [BR:bpar01007]
 Aminotransferase (transaminase)
  Class III
   BN117_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 13889794
NCBI-ProteinID: YP_006895714
UniProt: K0MEE1
LinkDB All DBs
Position
complement(1911872..1913146)
Genome map
AA seq 424 aa AA seqDB search
MDNAELTRRKEAATPRGVGVMCNFYADRAENAELWDTEGRRYIDFAGGIAVLNTGHRHPQ
LMQALQAQMSRFTHTAYQIVPYASYIQLAERINQLAPGDFAKKTALFTTGAEAVENAVKI
ARAATGRPAVVAFGAAFHGRTLLGMALTGKVVPYKVGFGPFPADIYHVPYPNALHGVSTD
DALAALGTLFKTDVDPRRVAAIIIEPVQGEGGFNICPPAFMQALRALCDDHGILLIADEV
QTGFGRTGKLFAMEHYGVAADLTAMAKSLAGGMPLSAVCGRAEVMDAPPPGGLGGTYAGN
PLAVAAALEVIRIIEAEDLLARGTRLGHQLRDHLEAQHHDVPEIAEVRALGAMVAVEFRQ
PGSDAPSPEFARQVQARALEQGLLLLTCGSDGNVIRFLFPLTIPEAVMREALDILARTLR
GQNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcagaactgacccgccgcaaggaggccgccacgccgcgcggcgtgggcgtg
atgtgcaacttctacgcggaccgcgccgagaacgccgaactgtgggataccgaaggccgc
cgctacatcgacttcgccggcggcatcgccgtgctcaacaccggccatcgccatccgcag
ctgatgcaggcgctgcaggcgcagatgagccgcttcacccacacggcctaccagatcgtc
ccgtacgccagctatatccagctggccgaacggatcaaccagctggcgccgggcgatttc
gccaagaagaccgccctcttcaccacgggagccgaggcggtcgagaacgccgtcaagatc
gcccgcgcggccaccggccggcccgccgtcgtcgccttcggcgcggcgttccacggccgc
acgctgctgggcatggccctgaccggcaaggtcgtgccgtacaaagtgggcttcggtccg
tttccggccgacatctaccatgtgccgtatccgaacgcgctgcacggggtatccaccgat
gacgcgctggcggccctggggaccctgttcaagaccgacgtggacccgcgccgcgtggcg
gccatcatcatcgaaccggtacagggcgagggcggtttcaatatctgcccgccggccttc
atgcaggcgctgcgcgccctgtgcgacgaccacggcatcctgctgatcgccgacgaagtc
cagaccggcttcggccgcaccggcaagctgttcgcgatggaacactacggcgtggcggcc
gacctgaccgccatggccaagagcctggccggcggcatgccgctgtcggcggtgtgcggc
cgcgccgaggtcatggacgcgccgccgccgggcggcctgggcggcacctatgccggcaat
ccgctggcggtggccgccgcgctggaggtgatccgcatcatcgaggccgaggacctgctg
gcgcgcggcacgcgcctgggccaccagttgcgcgaccacctggaggcgcagcaccacgac
gtccccgagatcgccgaggtgcgggcgctgggcgccatggtggcggtggaattccgccag
cccggcagcgatgcgcccagccccgaattcgcgcgccaggtccaggcccgcgcgctcgaa
caggggttgctgctcctgacctgcggcagcgacggcaacgtcatccgctttcttttcccg
ctgacgatcccggaggcggtcatgcgcgaagcgctggacatcctggcccggacgttgcgc
ggccagaacgcttga

DBGET integrated database retrieval system