KEGG   Bordetella parapertussis Bpp5: BN117_2732Help
Entry
BN117_2732        CDS       T02297                                 

Definition
(RefSeq) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00970  Aminoacyl-tRNA biosynthesis
bpar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN117_2732
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bpar03029]
    BN117_2732
Enzymes [BR:bpar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN117_2732
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN117_2732
Mitochondrial biogenesis [BR:bpar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN117_2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase GyrB_insert
Motif
Other DBs
NCBI-GeneID: 13890769
NCBI-ProteinID: YP_006896582
UniProt: K0MH96
LinkDB All DBs
Position
complement(2954497..2955846)
Genome map
AA seq 449 aa AA seqDB search
MLPTLTQQSLALQEGRDTSSGLTQAALARAADPAGEGARVFTRVYAEQARAEARAADALR
GAGVTRSAIDGLPISIKDLFDVAGETTMAGSVARQGEPAAVRDAVVVRRLRAAGAVIVGR
TNMTEFAYSGLGLNPHYGTPRNPWDRATGRIPGGSSSGAAVSVTDGMASGAIGSDTGGSV
RIPAALCGLAGFKPSAQRVSMQGVLPLSANLDSIGPLAPSVRCCATLDAILAGGDDADIP
APAALRGLRLAVPTTLALDGLDAHVSATFAATLAKLAEAGACIDEIVVPEFAQLADINSK
GGFTAAEAWAWHRDLIERAADRYDPRVVARIRRGADMSAADYIDLLAARQAWRARVEARI
AGYDALVLPTVPVVAPAIADLEASDALFGSTNLLILRNPTLINFLDGSALSLPCHEAGTA
PVGLMVAAANGSDRHVLAIGMAIEDLLGG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgacgttgacacaacaaagcctggccttgcaggaaggccgcgacacttccagc
gggctgacgcaagccgccctggcgcgcgccgccgatccggccggggagggcgcgcgcgtc
tttacgcgcgtgtacgccgagcaggcccgcgccgaggcccgcgcggccgatgcgctgcgc
ggcgccggcgtcacgcgctcggccatcgacggcctgcccatctcgatcaaggatctgttc
gacgtcgcgggcgaaaccaccatggccggttcggtcgcgcgccagggcgagcccgccgcg
gtccgcgacgcggtggtggtgcgccgcctgcgcgccgccggcgcggtcatcgtcggacgc
accaacatgaccgagttcgcctattcgggcctgggcctgaacccgcactacggcacgccc
cgcaacccctgggaccgcgccaccgggcgcattcccggcggctcctcttcgggcgcggcc
gtctcggtgaccgacggcatggccagcggggccatcggttcggacaccggcggatcggtg
cgcattccggccgcgctgtgcggcctcgccggtttcaagcccagcgcgcagcgtgtgtcc
atgcagggcgtgttgccgctgtcggccaacctcgattcgattggcccgctggcgccctcg
gtgcggtgctgcgccacgctcgacgccatcctggccggcggcgacgacgcggacatacca
gcgccggccgcgctgcgcggcctgcgcctggcagtaccgaccacgctggcgctcgacggc
ctggatgcgcatgtgtcggccacttttgccgcgacgctggcgaaactggccgaggcggga
gcgtgtatcgacgaaatcgtcgtgcccgagttcgcgcaactggccgacatcaacagcaag
ggcggctttaccgcggccgaggcctgggcctggcaccgcgacttgatcgaacgcgccgcc
gatcgctacgacccgcgcgtcgtggcgcgtatccgccgcggcgccgacatgtccgcggcc
gactacatcgatctgctggcggcccggcaagcctggcgggcccgggtcgaggcgcgcatc
gccggctacgatgccctggtcctgccgaccgtgccggtcgtcgcgcccgccatcgccgac
ctggaagcctccgatgccttgttcggctccaccaacctgctgatcctgcgcaatcccacg
ctgatcaacttcctcgacggcagcgcgctcagcctgccttgccacgaggccggcaccgcc
ccggtcgggctgatggtcgccgcggccaatggctcggaccggcacgtgctcgccatcggc
atggccatcgaagacctgctgggcgggtaa

DBGET integrated database retrieval system