KEGG   Butyrivibrio proteoclasticus: bpr_I1987Help
Entry
bpr_I1987         CDS       T01292                                 

Definition
(GenBank) PASTA domain-containing serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bpb  Butyrivibrio proteoclasticus
Brite
KEGG Orthology (KO) [BR:bpb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpb01001]
    bpr_I1987
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     bpr_I1987
Protein kinases [BR:bpb01001]
 Serine/threonine kinases: Other
  Bacterial family
   bpr_I1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Haspin_kinase Seadorna_VP7 Kdo Pkinase_fungal Biotin_lipoyl RIO1 SBP_bac_6 CDC45
Motif
Other DBs
NCBI-ProteinID: ADL34721
UniProt: E0RYM6
LinkDB All DBs
Position
1:complement(2419939..2422017)
Genome map
AA seq 692 aa AA seqDB search
MIKLGMVIGDRYEVLEKIGTGGMSDVYKAKDHKLNRLVAVKVLKQEFSENENFVSKFRVE
AQSTAGLMHPNIVNVYDVGDEDGVNYIVMELVDGITLKKYIEKKSRLSVKEAVSIAIQVA
MGLEAAHNNNIIHRDIKPQNIMISKEGKVKVTDFGIAKAATSNTITSNVMGSVHYTSPEQ
ARGGYSDAKSDIYSLGITLFEMLTGRVPFNGDTTVAIAIKHIQEELPTPADYNDEIPISV
EKIVLKCCQKSPDRRYQNAAELIADLKRSLITPDKDFVSLSNPDEEGATRVASEEEVSSV
KNGTGRFSDTEKMRLKDEELRDYEEDDSHYNDRDRDRDRDRDRDRDRRRTRRDYDEDDDF
YGYDRDRDRYRKQNPQGAGRIEKLTIAMAIVLAVLIGFMGLLLVGRKLGLVGNSEAGAEG
SSVAASSEASSGAAQEETADGIIIPDVSGKSYAEAVATLNEKGFKVEKGEDAGSSLAKDL
VSYTNPAAGNRAKSGATISVFVSTGANASAGNATAAVSTAKADGQVTVPNVIGKTSEEAV
IMLVEAGLTAGSVVETSNEDPNLTGLICAQSIAYGTSVSEGTVINMELSTGPATVTYSYV
SDISAPTEGENYQAGISVHVTLVTSDGTTLLNTTTSDFPIQMNSKGITSPTGTLTFVYTA
TSPTTTNEAGETVGGETKEITVTRAVTFTQEN
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttaggaatggtgatcggagaccgctatgaagtgcttgagaagattggcacc
ggcggcatgtccgatgtttataaagcaaaagatcataagcttaaccgccttgtagctgtt
aaggtactcaaacaggaattctccgaaaatgagaattttgtttccaagttccgtgtagag
gcacagtctacagcagggcttatgcatccaaatatcgttaatgtttatgatgtaggtgac
gaagatggtgtcaattacattgtaatggagcttgttgacggtattactcttaaaaagtac
attgaaaagaaatcaaggctatcagtcaaagaggctgtaagtatcgctattcaggtagct
atgggtcttgaggctgcacataacaacaacattatccacagagatatcaagcctcagaac
ataatgatttccaaggaaggtaaggttaaggttactgattttggtatagccaaggcagcg
accagtaatactatcacttccaatgttatgggatcagttcattacacatcacctgagcag
gcgagaggcggctatagtgatgccaagagtgatatttattcactgggtattactctcttt
gagatgttgacaggtcgtgttccttttaacggtgacacaactgtggctatagctatcaag
catattcaggaggaattacctactcctgcagattataatgatgagattccaatcagtgta
gagaaaattgttctcaagtgctgccagaagagtcctgacagaagatatcagaacgcagca
gagcttattgcagaccttaagcgttcacttataacacctgacaaggattttgtatctctt
tcaaatcctgatgaggagggtgccacaagagttgcttctgaagaggaggtttcttctgtt
aaaaatggtacaggcagattctcagacactgagaagatgagacttaaggatgaagaactt
cgcgattatgaggaagatgacagtcattacaatgatcgcgacagagatagagacagagac
cgcgacagagacagggatcgcagaagaactagacgagactacgacgaagatgacgatttc
tatggatatgacagggatcgcgacagatatcgtaagcagaatccacagggagcaggcaga
atagagaagcttactatcgctatggctatagtgcttgcagttctcattggatttatgggg
ctgttgctcgtcggaagaaagctcggtcttgtaggcaattctgaggccggagcagaagga
tcaagtgttgcagcaagttctgaggcaagctcaggagcagcccaggaggaaacagctgat
ggaatcataattcctgatgtttccggcaaatcatatgctgaggctgtagcaaccctcaat
gaaaaaggttttaaggttgaaaaaggtgaggatgcaggcagcagccttgccaaggacctt
gtatcatatactaatccggcagcaggtaacagagcaaagagcggagcaacgataagtgta
tttgtcagcacaggagctaatgcttctgcaggaaatgctaccgcagctgtttctacagcc
aaggcagatggacaggttacagttcctaatgttatcggcaagacttctgaagaggctgtt
atcatgctggtagaagccggacttacagcaggttctgttgttgagaccagcaatgaagac
cctaatcttacaggtcttatctgcgcacagagtattgcttatggaacatcagtatctgag
ggcacagtgatcaacatggagctttctacaggccctgcaactgttacatacagctatgtt
tcagatatttccgcacctactgagggcgagaactatcaggctggaatttcagttcatgtg
acacttgttacttcagatggaacaacacttcttaatacaactacttcagattttcctatt
cagatgaattccaagggaattacatctcctacaggaactctgacatttgtttatacagca
acatcacctacaactaccaatgaagcaggagagactgttggtggagagaccaaagagata
acagtaacaagagcagttacttttacacaggagaattaa

DBGET integrated database retrieval system