KEGG   Bordetella pertussis CS: BPTD_0267Help
Entry
BPTD_0267         CDS       T01846                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
bpc  Bordetella pertussis CS
Pathway
bpc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BPTD_0267
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpc02000]
    BPTD_0267
Transporters [BR:bpc02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    BPTD_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 AAA_29 ATP-synt_ab AAA_22 AAA_28 RsgA_GTPase Zeta_toxin MMR_HSR1 FtsK_SpoIIIE DUF87
Motif
Other DBs
NCBI-ProteinID: AEE65757
LinkDB All DBs
Position
complement(273390..275069)
Genome map
AA seq 559 aa AA seqDB search
MSLWRLLFRLYARRKGALALALALSLLTVAAGVGLLGVSGWFLTGAALAGAGAVFNLFVP
SSLVRGLSFIRIASRYGERLAGHAATLRLLADLRASVFRSLVRLTPRQLARYRGGDLVAR
LTSDVDALDTVFLFVLAPVAVALAGGAILTAVMGAWIPAAALVVAAALLLCCAVAPWWLA
RAGRRPGAAVQESAAALRAATLDAVEGHADIAALHAGAQARAQFADACEQSARARAAQVR
IAARGQWLAQLAAGAAVLAVLWFGLDGLAAGELGGPLLAGLLLATIGIFEVAGPVMRGVS
RLGAAVAAAARIGEIAAREPDLRDPAAPRALPPAGELALEDVTFAYPVPDAAPHPVLDGA
SLRVAPGQRVAIVGASGAGKSTVLQLLLRLEDPQRGAVRYAGCDVRECAQAELHRRVALL
SQDAPLLLGTVRTNLLIGDAQADDAALWRALDAARLGEVVRGLPHGLDTWIGETGAGLSA
GQARRLCLARALLTGASAILLDEPTAGLDAATEAELLADLARATQGRTVVLATHARLPPG
TVDTVYTLQAGRLHRAAPM
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtggcgcttactgttccgcttgtacgcgcgccgcaaaggcgcgctggcgctg
gccctggcgctgtcgctgctgaccgtggcggcgggcgtgggcctgctcggggtgtcgggc
tggttcctgaccggggcggcgctggccggcgcgggcgcggtgttcaatctgttcgtgccg
tcgtcgctggtgcgcggcctgtcgttcatccgcatcgcctcgcgctacggtgaacggctg
gccggccacgccgccacgctgcgcctgctggccgatctgcgggcctcggtattccgctcg
ctggtgcgcctgacgccgcgccaactggcgcgctaccgcggcggcgacttggtggcgcgg
ctgaccagcgacgtcgacgcgctggatacggtgttcctgttcgtgctggcgccggttgcg
gtggcgctggcgggcggcgccatcctgaccgcggtcatgggggcctggattccggccgcc
gcgctggtggtggccgcggccttgctgctgtgctgtgccgtggcgccctggtggctggcg
cgcgccggccgccggcccggcgcggcggtgcaggaaagcgcggcggccctgcgcgcggcg
acgctggatgcggtcgaaggccatgccgacatcgcggccctgcatgccggcgcccaggcg
cgcgcgcagttcgccgacgcgtgcgagcagtcggcccgcgcgcgcgcggcgcaggtgcgc
atcgccgcgcgcggccagtggctggcgcagttggccgccggcgcggcggtgctggccgtg
ctgtggttcgggctggacggactggcggcgggcgagctgggcggccccttgctggcgggc
ttgttgctggcgacgatcggcatcttcgaagtggccggcccggtcatgcgcggcgtttcg
cgcctgggcgctgcggtcgccgccgccgcgcgcatcggcgagatcgccgcgcgcgaaccc
gacctgcgcgatccggccgcgccgcgcgccttgccgccggcgggcgaactggcgctggag
gacgtgacgttcgcctatcccgtgcccgacgccgcgccgcatccggtgctcgacggcgcc
agcctgcgcgtcgcgcccgggcagcgcgtggccatcgtcggcgccagcggcgccggcaag
tcgaccgtgctgcagctgctgctgcgcctggaggacccgcagcgcggcgcggtgcgctac
gccggctgcgatgtgcgcgagtgcgcgcaggccgagctgcatcgccgcgtggccttgctg
tcgcaggatgcgccattgcttctcggcaccgtgcgcaccaatctgctgatcggcgacgcg
caggccgacgacgcggcgctgtggcgcgcgctggacgcggcgcgcctgggcgaggtggtg
cgtggcctgccgcacggcctcgatacgtggataggcgagaccggtgcgggactgtcggcc
ggccaggcgcgccgcctttgcctggcgcgcgcgttgctgaccggcgcatcggccatcctg
ctcgacgagcccaccgcgggcctggacgcggccaccgaggccgagctgctggcggatctg
gcgcgcgccacgcaggggcgcaccgtggtgctcgccacgcatgcccgcctgccgccgggt
acggtcgatacggtgtacacgctgcaagcaggccggctgcaccgcgccgcgcccatgtga

DBGET integrated database retrieval system