KEGG   Bordetella pertussis CS: BPTD_2248Help
Entry
BPTD_2248         CDS       T01846                                 

Definition
(GenBank) putative multidrug resistance protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
bpc  Bordetella pertussis CS
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpc02000]
    BPTD_2248
Transporters [BR:bpc02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   BPTD_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 OEP DUF4407 Tropomyosin_1 Fusion_gly THOC7
Motif
Other DBs
NCBI-ProteinID: AEE67539
LinkDB All DBs
Position
2434033..2435223
Genome map
AA seq 396 aa AA seqDB search
MSPSPTTHPARKRLLWLATGVFAVLAIAYAVWWALFGSHFESTDDAYVHGNLVQITPQVP
GTVVAIEADDTEAVTAGQALVRLDPADTDVALQQAEARLAQTVRQVRTLYVQNDALAADI
DVRQAEIARAQADLKRAQSDLQRRQTLAKSGGVSGEEILHAETALKSAQSALAQARANLA
AAQAKLATNQALTEGTTVAEHPDVRNAAAQVRNAWLNRSRTVLPAPVDGIVARRAAQVGQ
RVAPGAMLMNVVPLDQIWVEANFKEGQLRHMRIGQPARITADLYGGSVVYDGKVIGLDAG
TGSAFALLPAQNASGNWIKVVQRVPVRIALDPEQLKTHPLRVGLSMDVEVDVGAEEGQPV
TAAPRAEPALSTQVFEPAHDEADALIARIIQANLAS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctccccgaccacccaccccgcccgcaaacgcctgctgtggctggcaaccggt
gtgttcgccgtgctggccatcgcctatgccgtctggtgggcgctgttcggctcgcacttc
gagagcaccgacgacgcctatgtccacggcaacctggtgcagatcacgccgcaggtgccc
ggcaccgtcgtcgccatcgaggccgacgacaccgaggccgtgacggcgggccaggcgctg
gtgcggctggatccggccgacaccgacgtggcgctgcagcaggccgaggcgcgcctggcc
cagacggtgcgccaggtccgcacgctctacgtccagaacgacgccctggccgccgacatc
gacgtgcggcaggccgagatcgcgcgcgcccaggccgacctgaagcgcgcccagagcgac
ctgcagcggcgccagacgctggccaagtcgggcggcgtcagcggcgaggaaatcctgcac
gccgagaccgcgctcaagtccgcccagtcggccctggcgcaggcgcgcgccaacctggcc
gccgcccaggccaagctggcgaccaaccaggcgctgaccgagggcacgacggtggccgaa
catccggacgtgcgcaatgccgccgcccaggtgcgcaatgcctggctgaaccgttcgcgc
accgtgctgccggcgccagtcgacggcatcgtggcgcgccgcgccgcgcaggtcggccag
cgcgtcgcccccggcgccatgctgatgaacgtggtgccgctggaccagatctgggtcgag
gccaatttcaaggaagggcagctgcgccacatgcgcatcggccagcccgccaggatcacg
gccgacctgtacggcggttcggtggtctacgacggcaaggtcatcggcctggacgccggc
accggcagcgccttcgcgctgctgccggcgcagaacgcctcgggcaactggatcaaggtg
gtgcagcgggtgccggtgcgcatcgcgctggacccggagcagctcaagacccatccgctg
cgcgtgggcctgtccatggacgtcgaggtcgatgtcggggccgaggaaggccagcccgtg
accgccgcgccgcgcgccgaaccggccctctcgacccaggtgttcgagccggcgcacgat
gaagccgacgcgctgatcgcgcgcatcatccaggccaacctcgcatcatga

DBGET integrated database retrieval system