KEGG   Bordetella pertussis CS: BPTD_2319Help
Entry
BPTD_2319         CDS       T01846                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00020  Citrate cycle (TCA cycle)
bpc00190  Oxidative phosphorylation
bpc00650  Butanoate metabolism
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01120  Microbial metabolism in diverse environments
bpc01130  Biosynthesis of antibiotics
bpc01200  Carbon metabolism
Module
bpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPTD_2319 (sdhA)
   00650 Butanoate metabolism
    BPTD_2319 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BPTD_2319 (sdhA)
Enzymes [BR:bpc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BPTD_2319 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BPTD_2319 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like Thi4 FAD_binding_3 Lycopene_cycl Pyr_redox_3 NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEE67609
LinkDB All DBs
Position
complement(2524228..2526006)
Genome map
AA seq 592 aa AA seqDB search
MVAVMNSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVAARTQFFVEWMALDLLRNEAG
DVLGVTALEMETGEIYVLEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPDGSYVVLKLDHLGADVINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQ
MGGIPANYHGQVLERANGENKIVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGN
HIVDSHPERQHAHQPLPKEAVDRSLARVDELESRTSGEKTQDVANAIRMSMQRHCGVFRT
LELLNEGVGQIEDLAQTAQHIYFKDKSKVFNTARVEALELANMTEVARATIKSAANRTES
RGAHALNDHPERDDVNWLKHTLWYSEGSRLDYKPVQMKPLTVESFPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgctgtcatgaattccttgccgcgccgccagtttgatgtggtggtggtcggcgcc
ggcggagccggcatgcgctgttcgctgcaactggcccaggcgggcctgtcggttgcggtg
ctgtccaaagtgttcccgacccgttcgcacacggttgccgcgcaaggcggcgtgagcgcg
tcgctgggcaacatgagcgaagacaactggtactggcatatgtacgacaccgtcaagggg
tcggactggctgggcgaccaggatgccatcgagttcatgtgccgcgaggcgcccaatgcc
gtgtatgagctcgagcacttcggcatgccgttcgaccgcaacgccgacggcaccatctac
cagcgtccgttcggcggccatacggccaatttcggcgagaagccggtgcagcgcgcctgt
gccgccgccgaccgtaccggccacgcgctgctgcacacgctctaccagcgcaacgtcgcc
gcccgtacccagttcttcgtcgagtggatggcgctggacctgctgcgcaacgaagccggc
gacgtgctgggcgtgaccgcgctcgaaatggaaaccggcgagatctacgtcctggaagcc
aagaccacggtgctggccaccggcggcgccggccgtatctgggccgcttccacgaacgcc
ttcatcaacaccggcgacggcctgggcatggcggcgcgcgcgggcatcccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcatcctgctcaacaaggatggcgagcgcttcatggagcgc
tacgcgcccacgctgaaggacctggcgccgcgcgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggctgcggtcccgacggcagctacgtggtgctgaagctggat
cacctcggcgccgacgtgatcaacaagcgcctgccgtcgatccgtgagatcgccatcaag
ttcggcaacgtcgacccgatcaaggaaccgatccccgtcgtgccgaccatccactaccag
atgggcggcattcccgccaactaccacggccaggtgctcgagcgcgccaacggcgagaac
aagatcgtcaacggcctgtacgccatcggcgaatgcgccgcggtgtcggtgcacggcgcc
aaccgcctgggcaccaattcgctgctggacctgatcgtcttcggccgtgccaccggcaac
catatcgtcgactcgcatcccgagcgccagcacgcccaccagccgctgcccaaggaagcc
gtcgaccggtcgctggcgcgcgtcgacgagctggagtcgcgcacttcgggcgagaagacc
caggacgtcgccaacgccatccgcatgtcgatgcagcgccattgcggcgtgttccgcacg
ctggagctgctcaacgagggcgtgggccagatcgaagacctggcgcagacggcccagcac
atctacttcaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaggcgctggaactg
gccaacatgaccgaggtggcgcgcgccaccatcaagtcggccgccaaccgcaccgaaagc
cgcggcgcgcatgcgctgaacgaccatcccgagcgcgacgacgtgaactggctcaagcat
acgctgtggtattcggaaggcagccgcctcgactacaagcccgttcagatgaagccgctg
acagtggaatccttcccgcccaaggctcgtactttctaa

DBGET integrated database retrieval system