KEGG   Bordetella pertussis CS: BPTD_3535Help
Entry
BPTD_3535         CDS       T01846                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bpc  Bordetella pertussis CS
Pathway
bpc00220  Arginine biosynthesis
bpc01100  Metabolic pathways
bpc01110  Biosynthesis of secondary metabolites
bpc01130  Biosynthesis of antibiotics
bpc01210  2-Oxocarboxylic acid metabolism
bpc01230  Biosynthesis of amino acids
Module
bpc_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bpc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BPTD_3535
Enzymes [BR:bpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BPTD_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEE68715
LinkDB All DBs
Position
3839517..3840689
Genome map
AA seq 390 aa AA seqDB search
MHAPGNSMDTRAWLETLVAIDTTSRNSNLALIETVRDWLGRQGVQAWLAHNPERTKANLF
ATLPASDGAEQGGIVLSGHTDVVPVDGQDWSADPFALREQEGRLYGRGSCDMKGFIAASL
ALVPAFLEMPRKKPIHLAFSYDEEVGCAGAPVMLADLRERGIQPEGCVVGEPTGMQVVVA
HKGINLFRCRVHGKAAHSSLTPRGCNAIEYAARLICRIRDLADAYKANGPYDEFYDVPFS
TMTTNQIHGGIAVNTIPELCEFSYEFRNLPGMPADAIQAEVERYVRDELLPRMRAEYTQA
RIDIETGAAAPGLEASEQAAITQLVRSLTADRVTRKVAYGTEAGLFQGIGIPTVVCGPGH
IEQAHKPDEYVALDQLAACEAFLRRLGQSL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgctccggggaattccatggacactcgcgcctggctcgagacgctggtggctatc
gacaccaccagccgcaattccaacctggcgttgatcgaaaccgtgcgggactggctcggc
cggcagggcgtgcaggcctggctggcgcacaaccccgagcgcaccaaggccaatctgttc
gccacgctgccagccagcgatggcgcggagcagggcggcatcgtgctgtccggccatacc
gatgtcgtgccggtcgatggacaggactggtccgccgacccgttcgccttgcgcgaacag
gaggggcggttgtacgggcggggttcgtgcgacatgaagggcttcatcgccgcgtcgctg
gccctggtgccggcgttcctggagatgccccgcaagaaacccatccatctggcgttttcg
tatgacgaggaggtcggctgtgccggcgcgcccgtcatgctggccgacctgcgcgaacgc
ggcatccagccggagggctgcgtggtcggcgagcctaccggcatgcaggtggtggtggcg
cacaagggcatcaacctgtttcgctgccgggtccatggcaaggcggcgcattcgtcgctg
acgccgcgcggctgcaacgccatcgaatacgcggcgcggctgatctgccgcatccgcgac
ctggccgacgcgtacaaggccaacggcccgtatgacgagttctacgatgtgccgttctcg
accatgaccaccaaccagatccacggcgggatcgcggtcaacaccatccccgagctgtgc
gagttctcgtacgagttccgcaacctgccgggcatgccggccgacgccatccaggccgag
gtcgagcgctacgtgcgcgacgagttgctgccgcgcatgcgcgccgaatacacgcaagcc
cgcatcgacatcgaaaccggcgccgcggcgcccggcctggaggcgtccgagcaggccgcc
atcacgcaactggtgcgctccctgaccgcggaccgggtcacccgcaaggtggcctacggg
accgaggccggcctgttccagggcatcggcatccctaccgtggtgtgcgggccgggccat
atcgaacaggcccacaagcccgatgaatacgtggcgctggaccagctggccgcctgcgag
gccttcctgcggcggctcggacagtcgctctag

DBGET integrated database retrieval system