KEGG   Burkholderia pseudomallei 668: BURPS668_0930Help
Entry
BURPS668_0930     CDS       T00481                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpd  Burkholderia pseudomallei 668
Brite
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BURPS668_0930 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABN83421
UniProt: A3N6L0
LinkDB All DBs
Position
I:908219..908797
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPHISQETIQFHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQIWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLVTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctgccgtacgctgaagacgccctcgctccgcatatctcg
caggagacgatccagtttcactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatccccggcaccgagttcgagaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggcatcttcaacaacgccgcgcagatctggaatcacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgcgccgacgggtgcgctcggcgacgcgatcaacgcgaag
tggggttcgttcgacgcgttcaaggaggcgttcacgaaggcagcggtcggcacgttcggc
tcgggctgggcttggctcgtgaagaaggcggacggctcgctcgacatcgtgtcgacgagc
aatgcggccacgccgctcacgacggccgacaagccgctcgtcacgatcgacgtgtgggaa
cacgcttactacatcgattaccgcaacgcgcgcccgaagttcgtcgaagcgttctggaac
atcgtgaactgggacttcgccgcgaagaacttcgcgtaa

DBGET integrated database retrieval system