KEGG   Burkholderia pseudomallei 668: BURPS668_1911Help
Entry
BURPS668_1911     CDS       T00481                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpd  Burkholderia pseudomallei 668
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS668_1911
Enzymes [BR:bpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BURPS668_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABN82607
UniProt: A3N9C5
LinkDB All DBs
Position
I:1872733..1873824
Genome map
AA seq 363 aa AA seqDB search
MTNRNDETQQMTAIVCHAPEDYRVERVAKPRANARELVIRIGACGICASDCKCHAGAKMF
WGGPSPWVKAPVIPGHEFFGYVEALGEGAAEHFGVALGDRVIAEQIVPCGTCRYCKSGQY
WMCEVHHIFGFQREVADGGMAEYMRIPSGAIVHPVPLGISLEDAAIIEPLACAIHTVNRG
DIQLDDVVVIAGAGPLGLMMTQVAKLKTPRRLVVVDPVEARRALARAYGADVTIDPARED
APAIVRALTGGYGCDVYIETTGVPAGVTQGMALIRKLGRFVEFSVFGKDTALDWSIIGDR
KELDVRGAHLGPYCYPVAIDLLARGLVTSKGIVTHGFSLDEWDEAIRVANSLDSIKVLMK
PRG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgaaacgacgaaacgcagcagatgacggcgatcgtctgccacgcccccgag
gactaccgcgtcgagcgcgtcgcgaagccgcgcgcgaacgcgcgcgagctcgtgatccgc
atcggcgcgtgcggcatctgcgcgagcgactgcaagtgccacgccggcgcgaagatgttc
tggggcgggccgagcccgtgggtcaaggcacccgtgattcccggccacgagttcttcggc
tacgtcgaggcgctgggcgagggcgcggccgagcacttcggcgtcgcgctcggcgatcgc
gtgatcgccgagcagatcgtgccgtgcggcacgtgccgctattgcaagtcgggccagtac
tggatgtgcgaggtccatcacatcttcggctttcagcgcgaggtcgccgacggcgggatg
gccgagtacatgcgcataccgtcgggcgcgatcgtccacccggtcccgctcggcatctcg
ctcgaggacgcggcgatcatcgagccgctcgcgtgcgcgatccacacggtcaatcgcggc
gacatccagctcgacgacgtcgtcgtgatcgcgggcgcgggcccgctcggcctgatgatg
acgcaggtcgcgaagctgaagacgcccaggcggctcgtcgtcgtcgatcccgtcgaagcg
cggcgcgcgctcgcgcgcgcatacggcgccgacgtgacgatcgatccggcccgcgaggac
gcgcccgcgatcgtgcgcgcgctgacggggggctacggctgcgacgtctacatcgagacg
accggcgtgccggcgggcgtcacgcagggcatggcgctgatccgcaagctcggccgcttc
gtcgagttctcggtgttcggcaaggatacggcgctcgactggtcgatcatcggcgatcgc
aaggagctcgatgtgcgcggcgcgcatctcggcccgtattgctatcctgtcgcgatcgat
ctgctcgcgcgcgggctcgtcacgtcgaagggcatcgtcacgcacggcttctcgctcgac
gaatgggacgaggcgatccgggtcgcgaactcgctcgactcgatcaaggtgctgatgaag
ccgcgcggctga

DBGET integrated database retrieval system