KEGG   Burkholderia pseudomallei 668: BURPS668_2611Help
Entry
BURPS668_2611     CDS       T00481                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00010  Glycolysis / Gluconeogenesis
bpd00020  Citrate cycle (TCA cycle)
bpd00620  Pyruvate metabolism
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
bpd01120  Microbial metabolism in diverse environments
bpd01130  Biosynthesis of antibiotics
bpd01200  Carbon metabolism
Module
bpd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS668_2611 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BURPS668_2611 (pdhB)
   00620 Pyruvate metabolism
    BURPS668_2611 (pdhB)
Enzymes [BR:bpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BURPS668_2611 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABN84332
UniProt: A3NBB6
LinkDB All DBs
Position
I:complement(2579751..2581382)
Genome map
AA seq 543 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSQGSLIVVLEASGGAAASAPQAAAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGEYRAS
HASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPAGGGE
LNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRVQ
LNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTPNGLV
VPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTPIINA
PEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLADFRR
IIL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggacgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcgcaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgccggccgcgccggctccggcgcccgcgccgcaggccgcacccgcg
gctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgagtaccgcgcgagc
cacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgacgtgtcgcgcgtc
acgggcacggggccgaagagccgcatcacgaaggacgacgtcaccgcgttcgtgaagggc
gtgatgacggggcagcgcgcggcgcccggcgccgcggccgcgcccgcgggcggcggcgag
ctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccgttcgaggcgaag
ccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaactgggtgatgatc
ccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaagcgctgcgcgtgcaa
ctgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcgttcgtgatcaag
gcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctcgacggcgacaac
ctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccgaacggcctcgtc
gtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcgaaggaaatggcc
gagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatgcagggcggctgc
ttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacgccgatcatcaatgcg
ccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtgtgggacggcaag
cagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtatgaccatcgcgtgatcgat
ggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgccgatttccgtcgc
atcattctttga

DBGET integrated database retrieval system