Burkholderia pseudomallei 668: BURPS668_2789 Help Entry BURPS668_2789     CDS       T00481                                  Gene name acpP Definition (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bpd  Burkholderia pseudomallei 668 Pathway bpd00998   Biosynthesis of various secondary metabolites - part 2 bpd01100   Metabolic pathways bpd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bpd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BURPS668_2789 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various secondary metabolites - part 2     BURPS668_2789 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABN83623 UniProt:  A3NBT9 LinkDB All DBs Position I:complement(2755326..2755565) Genome map AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system