KEGG   Burkholderia pseudomallei 668: BURPS668_2789
Entry
BURPS668_2789     CDS       T00481                                 

Gene name
acpP
Definition
(GenBank) acyl carrier protein
  KO
K02078  acyl carrier protein
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00998  Biosynthesis of various secondary metabolites - part 2
bpd01100  Metabolic pathways
bpd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BURPS668_2789 (acpP)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BURPS668_2789 (acpP)
SSDB
Motif
Pfam: PP-binding PP-binding_2 Ribosomal_L50 DUF1896 DUF1493
Other DBs
NCBI-ProteinID: ABN83623
UniProt: A3NBT9
LinkDB
Position
I:complement(2755326..2755565)
AA seq 79 aa
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA
EKITTVQQAIDYARANVKA
NT seq 240 nt   +upstreamnt  +downstreamnt
atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa
gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg
gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc
gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system