KEGG   Burkholderia pseudomallei 668: BURPS668_3306
Entry
BURPS668_3306     CDS       T00481                                 

Gene name
phnL
Definition
(GenBank) phosphonate C-P lyase system protein PhnL
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00440  Phosphonate and phosphinate metabolism
bpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS668_3306 (phnL)
Enzymes [BR:bpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BURPS668_3306 (phnL)
SSDB
Motif
Pfam: ABC_tran AAA_16 AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_22 AAA_33 AAA_30 AAA_23 AAA_28 TsaE AAA_18 MMR_HSR1 AAA_25 AAA_14 NTPase_1 cobW Rad17
Other DBs
NCBI-ProteinID: ABN82450
UniProt: A3ND96
LinkDB
Position
I:complement(3247336..3248133)
AA seq 265 aa
MQTIESSRRARDHDHARAFAGNAALMLRAVGVGKTFTLHAHGGMTIDALENVSLDVEAGE
CVALTGPSGAGKSTLLRCLYGNYLANRGTIAVRAGARAAEHVVLTASEPHEVIALRRDVI
GYVSQFLRAIPRVPALALVAAPLVARGMPEGDAADRAAHLLARLNVPRRLWTLAPATFSG
GEQQRVNIARGLIAEHPVLLLDEPTASLDAENRDVVAELIGDVRRHGAAIVGIFHDEATR
ERVATRCFPLRPPSRARLPFDEVNA
NT seq 798 nt   +upstreamnt  +downstreamnt
atgcaaaccatcgaatcgtcccgccgcgcccgcgatcacgatcacgcccgcgcgttcgcc
ggcaacgcggcgctgatgctgcgcgcggtcggcgtcggcaagacgttcacgctgcatgcg
cacggcggcatgacgatcgacgcgctcgagaacgtgtcgctcgatgtcgaagcgggcgag
tgcgtcgcgctcacggggccgtccggcgcgggcaagagcacgctgctgcggtgcctgtac
ggcaactatctcgcgaaccgcggcacgatcgcggtgcgcgccggcgcgcgcgcggcggag
cacgtcgtgttgacggcgtccgagccgcacgaggtgatcgcgctgcggcgcgacgtgatc
ggctacgtcagccagttcctgcgggcgattccgcgggtgccggcgcttgcgctcgtcgcc
gcgccgctcgtcgcgcgcggcatgcccgaaggcgatgcggccgatcgcgcggcgcatctg
ctcgcgcgcctgaacgtgccgcgccggctgtggacgctcgcgcccgcgacgttttcgggc
ggcgagcagcagcgcgtgaacatcgcgcgcgggttgatcgccgagcatccggtgctgctg
ctcgacgagccgacggcgtcgctcgacgcggagaatcgcgacgtcgtcgccgagctgatc
ggcgacgtgcgccggcacggcgcggcgatcgtcggcatctttcacgacgaagcgacgcgc
gagcgcgtcgcgacgcgctgtttcccgctgcgcccgccgtcgcgcgcgcggctgcccttt
gacgaagtgaacgcttag

DBGET integrated database retrieval system